Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PRKG1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13976
Molecular weight:
36.25 kDa

Original price was: €278.00.Current price is: €230.00.

50ug 17% OFF + 230 loyalty points
Tyr336–Thr631
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PRKG1 Protein, N-His

Product name ARO-P12273-100
Uniprot ID Q13976
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGT
Molecular weight 36.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr336-Thr631
Aliases /Synonyms cGKI, cGMP-dependent protein kinase 1, PRKG1B, PRKGR1B, cGK 1, PRKGR1A, PRKG1, cGK1, cGMP-dependent protein kinase I
Reference ARO-P12273
Note For research use only.
Molecular Constructor
Tyr336–Thr631
Product name ARO-P12273-1MG
Uniprot ID Q13976
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGT
Molecular weight 36.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr336-Thr631
Aliases /Synonyms cGKI, cGMP-dependent protein kinase 1, PRKG1B, PRKGR1B, cGK 1, PRKGR1A, PRKG1, cGK1, cGMP-dependent protein kinase I
Reference ARO-P12273
Note For research use only.
Molecular Constructor
Tyr336–Thr631
Product name ARO-P12273-50
Uniprot ID Q13976
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGT
Molecular weight 36.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr336-Thr631
Aliases /Synonyms cGKI, cGMP-dependent protein kinase 1, PRKG1B, PRKGR1B, cGK 1, PRKGR1A, PRKG1, cGK1, cGMP-dependent protein kinase I
Reference ARO-P12273
Note For research use only.
Molecular Constructor
Tyr336–Thr631

Introduction to Recombinant Human PRKG1 Protein

Recombinant Human PRKG1 Protein, also known as cGMP-dependent protein kinase 1, is a crucial enzyme involved in various cellular processes such as smooth muscle relaxation, platelet activation, and neuronal signaling. This protein is encoded by the PRKG1 gene and is a key component of the nitric oxide-cGMP signaling pathway. Recombinant PRKG1 protein is produced through recombinant DNA technology and has numerous applications in the fields of research and medicine.

Structure of Recombinant Human PRKG1 Protein

The PRKG1 gene is located on chromosome 10 in humans and encodes for a 75 kDa protein. The recombinant PRKG1 protein is a homodimer consisting of two identical subunits, each with a molecular weight of approximately 78 kDa. Each subunit is composed of three functional domains – an N-terminal regulatory domain, a catalytic domain, and a C-terminal autoinhibitory domain. The regulatory domain contains two cGMP-binding sites, while the catalytic domain is responsible for the kinase activity of the protein. The C-terminal autoinhibitory domain regulates the activity of the kinase by binding to the catalytic domain in the absence of cGMP.

Activity of Recombinant Human PRKG1 Protein

Recombinant Human PRKG1 Protein is a serine/threonine kinase that is activated by the binding of cGMP to its regulatory domain. This activation leads to the release of the autoinhibitory domain, allowing the kinase to phosphorylate its target proteins. The main function of PRKG1 is to regulate the levels of cGMP in cells by phosphorylating various proteins involved in cGMP synthesis and degradation. This, in turn, affects various cellular processes such as smooth muscle relaxation, platelet activation, and neuronal signaling.

One of the key targets of PRKG1 is myosin light chain (MLC), a protein involved in smooth muscle contraction. Phosphorylation of MLC by PRKG1 leads to its inactivation, resulting in smooth muscle relaxation. This is particularly important in blood vessels, where PRKG1-mediated vasodilation helps regulate blood pressure. PRKG1 also plays a crucial role in platelet activation by phosphorylating vasodilator-stimulated phosphoprotein (VASP), which regulates the formation of blood clots. In neurons, PRKG1 is involved in synaptic plasticity and memory formation by regulating the activity of various ion channels and receptors.

Applications of Recombinant Human PRKG1 Protein

Recombinant Human PRKG1 Protein has numerous applications in research and medicine due to its role in various cellular processes. One of the major applications of this protein is in the study of the nitric oxide-cGMP signaling pathway. Researchers use recombinant PRKG1 protein to investigate the mechanisms of cGMP-dependent signaling and its role in various diseases such as hypertension, erectile dysfunction, and neurological disorders.

In medicine, PRKG1 protein has potential therapeutic applications in the treatment of cardiovascular diseases. Recombinant PRKG1 protein can be used to develop drugs that target the nitric oxide-cGMP signaling pathway, which is dysregulated in conditions such as hypertension and heart failure. Furthermore, PRKG1 has been shown to play a crucial role in the regulation of blood pressure, making it a potential target for antihypertensive drugs.

Another potential application of recombinant PRKG1 protein is in the treatment of erectile dysfunction. The nitric oxide-cGMP signaling pathway is essential for penile erection, and PRKG1 plays a crucial role in this process. Drugs targeting PRKG1 could potentially be used to treat erectile dysfunction by enhancing the effects of nitric oxide on smooth muscle relaxation in the penis.

Conclusion

In summary, Recombinant Human PR

Recombinant Human PRKG1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PRKG1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products