Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NFKBID, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8NI38
Molecular weight:
28.18 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
Asp46–Val285
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NFKBID, N-His

Product name ARO-P13230-100
Uniprot ID Q8NI38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPV
Molecular weight 28.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp46-Val285
Aliases /Synonyms NFKB inhibitor delta, IkB-delta, TA-NFKBH, NF-kappa-B inhibitor delta, IkappaBNS, I-kappa-B-delta, T-cell activation NFKB-like protein, IKBNS, IkappaBdelta, NFKBID
Reference ARO-P13230
Note For research use only.
Molecular Constructor
Asp46–Val285
Product name ARO-P13230-1MG
Uniprot ID Q8NI38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPV
Molecular weight 28.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp46-Val285
Aliases /Synonyms NFKB inhibitor delta, IkB-delta, TA-NFKBH, NF-kappa-B inhibitor delta, IkappaBNS, I-kappa-B-delta, T-cell activation NFKB-like protein, IKBNS, IkappaBdelta, NFKBID
Reference ARO-P13230
Note For research use only.
Molecular Constructor
Asp46–Val285
Product name ARO-P13230-50
Uniprot ID Q8NI38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPV
Molecular weight 28.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp46-Val285
Aliases /Synonyms NFKB inhibitor delta, IkB-delta, TA-NFKBH, NF-kappa-B inhibitor delta, IkappaBNS, I-kappa-B-delta, T-cell activation NFKB-like protein, IKBNS, IkappaBdelta, NFKBID
Reference ARO-P13230
Note For research use only.
Molecular Constructor
Asp46–Val285

Title: Introduction to Recombinant Human NFKBID: Structure, Activity and Applications

Recombinant Human NFKBID, also known as nuclear factor-kappa B inhibitor delta (NFKBID), is a protein that plays a crucial role in regulating the activity of the transcription factor NF-kappa B. This protein is encoded by the NFKBID gene and is a member of the I-kappa-B family of proteins, which are known to inhibit the activity of NF-kappa B.

Structure of Recombinant Human NFKBID:

The recombinant form of human NFKBID is a 37 kDa protein with a total of 327 amino acids. It consists of an N-terminal domain, a central ankyrin repeat domain, and a C-terminal domain. The N-terminal domain is responsible for binding to NF-kappa B, while the ankyrin repeat domain is involved in protein-protein interactions. The C-terminal domain contains a PEST motif, which is important for regulating the stability of the protein.

Activity of Recombinant Human NFKBID:

The primary function of recombinant human NFKBID is to inhibit the activity of NF-kappa B, a transcription factor that plays a critical role in the regulation of immune responses, inflammation, and cell survival. NFKBID achieves this by binding to the Rel homology domain of NF-kappa B, thereby preventing its translocation into the nucleus and subsequent activation of target genes. This inhibition of NF-kappa B activity by NFKBID is crucial for maintaining immune homeostasis and preventing excessive inflammation.

Applications of Recombinant Human NFKBID:

1. Recombinant Human NFKBID as a research tool:

Recombinant human NFKBID has been widely used as a research tool to study the role of NF-kappa B in various cellular processes. Its ability to specifically inhibit NF-kappa B activity has allowed researchers to elucidate the downstream effects of NF-kappa B signaling in different cell types and disease models.

2. Recombinant Human NFKBID in drug discovery:

Given the importance of NF-kappa B in various diseases, NFKBID has been explored as a potential therapeutic target. Recombinant human NFKBID has been used in high-throughput screening assays to identify small molecule inhibitors of NF-kappa B, which could potentially be developed into drugs for the treatment of inflammatory and autoimmune diseases.

3. Recombinant Human NFKBID in cancer research:

NF-kappa B is known to play a role in cancer development and progression. As a specific inhibitor of NF-kappa B, recombinant human NFKBID has been studied in various cancer models to understand its potential as a therapeutic agent. It has been shown to inhibit the growth of cancer cells and sensitize them to chemotherapy and radiotherapy, making it a promising candidate for cancer therapy.

4. Recombinant Human NFKBID in vaccine development:

NF-kappa B is also involved in the regulation of immune responses to pathogens. Recombinant human NFKBID has been used in vaccine development to enhance the immune response against specific antigens. By inhibiting NF-kappa B, NFKBID can promote the activation of antigen-presenting cells and enhance the production of antibodies against the target antigen.

In conclusion, recombinant human NFKBID is a crucial protein that plays a significant role in regulating NF-kappa B activity. Its structure, activity, and applications make it a valuable tool in various fields of research, including drug discovery, cancer research, and vaccine development. Further studies on this protein may lead to the development of novel therapeutics for the treatment of various diseases.

Recombinant Human NFKBID, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NFKBID, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products