Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EP300, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q09472
Molecular weight:
16.27 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
His2283–His2414
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EP300, N-His

Product name ARO-P12865-100
Uniprot ID Q09472
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His2283-His2414
Aliases /Synonyms Histone crotonyltransferase p300, Protein lactyltransferas p300, Protein propionyltransferase p300, Histone acetyltransferase p300, Protein 2-hydroxyisobutyryltransferase p300, EP300, p300 HAT, Histone butyryltransferase p300, P300, E1A-associated protein p300
Reference ARO-P12865
Note For research use only.
Molecular Constructor
His2283–His2414
Product name ARO-P12865-1MG
Uniprot ID Q09472
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His2283-His2414
Aliases /Synonyms Histone crotonyltransferase p300, Protein lactyltransferas p300, Protein propionyltransferase p300, Histone acetyltransferase p300, Protein 2-hydroxyisobutyryltransferase p300, EP300, p300 HAT, Histone butyryltransferase p300, P300, E1A-associated protein p300
Reference ARO-P12865
Note For research use only.
Molecular Constructor
His2283–His2414
Product name ARO-P12865-50
Uniprot ID Q09472
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His2283-His2414
Aliases /Synonyms Histone crotonyltransferase p300, Protein lactyltransferas p300, Protein propionyltransferase p300, Histone acetyltransferase p300, Protein 2-hydroxyisobutyryltransferase p300, EP300, p300 HAT, Histone butyryltransferase p300, P300, E1A-associated protein p300
Reference ARO-P12865
Note For research use only.
Molecular Constructor
His2283–His2414

Introduction to Recombinant Human EP300

Recombinant Human EP300, also known as E1A binding protein p300, is a protein that plays a crucial role in regulating gene expression and cell growth. It is a member of the histone acetyltransferase (HAT) family and is involved in various cellular processes such as transcription, DNA repair, and cell cycle control. In this article, we will explore the structure, activity, and applications of Recombinant Human EP300.

Structure of Recombinant Human EP300

Recombinant Human EP300 is a large protein consisting of 2414 amino acids with a molecular weight of approximately 300 kDa. It is composed of several functional domains, including the N-terminal transactivation domain, the central HAT domain, the C-terminal binding domain, and the bromodomain. The N-terminal domain is responsible for protein-protein interactions, while the HAT domain is responsible for acetylating histone and non-histone proteins. The C-terminal domain is involved in DNA binding and transcriptional activation, and the bromodomain is involved in recognizing acetylated lysine residues on histones.

Activity of Recombinant Human EP300

Recombinant Human EP300 is a multifunctional protein with diverse activities. Its main function is to acetylate lysine residues on histones, which leads to a more relaxed chromatin structure and promotes gene transcription. In addition to histones, EP300 can also acetylate several non-histone proteins, including transcription factors, co-activators, and tumor suppressors. This acetylation process plays a crucial role in regulating gene expression and cell growth.

Moreover, Recombinant Human EP300 has been shown to have histone deacetylase (HDAC) activity, which counteracts its HAT activity. This dual function of EP300 allows for precise regulation of gene expression. Furthermore, EP300 also has E3 ubiquitin ligase activity, which is involved in protein degradation and DNA repair.

Applications of Recombinant Human EP300

Due to its crucial role in gene expression and cell growth, Recombinant Human EP300 has numerous applications in both research and medicine. One of its main applications is in the study of epigenetics, which is the study of how gene expression is regulated by factors other than changes in the DNA sequence. EP300’s ability to acetylate histones and other proteins makes it an essential tool in understanding epigenetic mechanisms.

Moreover, EP300 has been implicated in various diseases, including cancer, neurodegenerative disorders, and metabolic disorders. In cancer, EP300 is often mutated or dysregulated, leading to abnormal gene expression and uncontrolled cell growth. Therefore, EP300 inhibitors are being developed as potential therapeutic agents for cancer treatment.

In addition, EP300 has been shown to play a crucial role in learning and memory, making it a potential target for cognitive disorders such as Alzheimer’s disease. It is also involved in metabolic processes, and EP300 mutations have been linked to metabolic disorders such as obesity and diabetes.

Conclusion

In conclusion, Recombinant Human EP300 is a multifunctional protein with diverse activities and essential roles in regulating gene expression and cell growth. Its structure, activity, and applications make it a valuable tool in both research and medicine. With ongoing studies and developments, the potential of EP300 in understanding and treating various diseases continues to grow.

Recombinant Human EP300, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EP300, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products