Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DEFB119, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N690
Molecular weight:
34.33 kDa

Original price was: €271.00.Current price is: €230.00.

50ug 15% OFF + 230 loyalty points
Lys22–Pro84
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DEFB119, N-GST

Product name ARO-P13250-100
Uniprot ID Q8N690
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
Molecular weight 34.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Pro84
Aliases /Synonyms Defensin, beta 120, DEFB119, DEFB-20, DEFB20, Beta-defensin 120, DEFB-19, Beta-defensin 20, DEFB120, DEFB19, ESC42-RELA, Beta-defensin 19, Beta-defensin 119, Defensin, beta 119
Reference ARO-P13250
Note For research use only.
Molecular Constructor
Lys22–Pro84
Product name ARO-P13250-1MG
Uniprot ID Q8N690
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
Molecular weight 34.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Pro84
Aliases /Synonyms Defensin, beta 120, DEFB119, DEFB-20, DEFB20, Beta-defensin 120, DEFB-19, Beta-defensin 20, DEFB120, DEFB19, ESC42-RELA, Beta-defensin 19, Beta-defensin 119, Defensin, beta 119
Reference ARO-P13250
Note For research use only.
Molecular Constructor
Lys22–Pro84
Product name ARO-P13250-50
Uniprot ID Q8N690
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
Molecular weight 34.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Pro84
Aliases /Synonyms Defensin, beta 120, DEFB119, DEFB-20, DEFB20, Beta-defensin 120, DEFB-19, Beta-defensin 20, DEFB120, DEFB19, ESC42-RELA, Beta-defensin 19, Beta-defensin 119, Defensin, beta 119
Reference ARO-P13250
Note For research use only.
Molecular Constructor
Lys22–Pro84

Introduction to Recombinant Human DEFB119

Recombinant Human DEFB119, also known as human beta-defensin 119, is a small protein that belongs to the defensin family. Defensins are a class of antimicrobial peptides that are produced by various cells in the human body, including epithelial cells, neutrophils, and macrophages. These peptides play a crucial role in the innate immune system by providing protection against a wide range of pathogens, including bacteria, viruses, and fungi.

Structure of Recombinant Human DEFB119

Recombinant Human DEFB119 is a 39 amino acid protein with a molecular weight of approximately 4.4 kDa. It is composed of a β-sheet structure, with three disulfide bonds that help maintain its stability. The three-dimensional structure of DEFB119 is similar to other defensins, with a characteristic α-helix and β-sheet motif. This unique structure allows DEFB119 to interact with the bacterial cell membrane, disrupting its integrity and leading to cell death.

Activity of Recombinant Human DEFB119

Recombinant Human DEFB119 has broad-spectrum antimicrobial activity against both Gram-positive and Gram-negative bacteria, as well as certain viruses and fungi. It exerts its antimicrobial effects by disrupting the integrity of the bacterial cell membrane, causing leakage of intracellular contents and ultimately leading to cell death. In addition to its antimicrobial activity, DEFB119 also has immunomodulatory properties. It can stimulate the production of pro-inflammatory cytokines and chemokines, which play a crucial role in the recruitment and activation of immune cells.

Application of Recombinant Human DEFB119

The antimicrobial and immunomodulatory properties of Recombinant Human DEFB119 make it a promising candidate for various therapeutic applications. One of the most significant applications of DEFB119 is in the treatment of bacterial infections. Its broad-spectrum activity and low potential for developing resistance make it a valuable alternative to conventional antibiotics. DEFB119 has also shown promising results in the treatment of viral infections, including herpes simplex virus and influenza virus. Its ability to stimulate the production of pro-inflammatory cytokines and chemokines makes it a potential adjuvant in vaccine development.

Apart from its antimicrobial activity, DEFB119 has also shown potential in the treatment of inflammatory conditions. Studies have shown that it can inhibit the production of pro-inflammatory cytokines and reduce inflammation in animal models of inflammatory diseases, such as colitis and psoriasis. This makes DEFB119 a potential therapeutic option for these diseases in the future.

In addition to its therapeutic applications, Recombinant Human DEFB119 also has potential diagnostic applications. It can be used as a biomarker for certain diseases, as its levels have been found to be elevated in conditions such as inflammatory bowel disease and psoriasis. Measuring DEFB119 levels can aid in the diagnosis and monitoring of these diseases.

Conclusion

In summary, Recombinant Human DEFB119 is a small protein with potent antimicrobial and immunomodulatory properties. Its unique structure and activity make it a promising candidate for various therapeutic applications, including the treatment of bacterial and viral infections, inflammatory diseases, and as a potential adjuvant in vaccine development. Further research and clinical trials are needed to fully explore the potential of DEFB119 in these applications.

Recombinant Human DEFB119, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human DEFB119, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products