Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DARS2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6PI48
Molecular weight:
68.95 kDa

Original price was: €288.00.Current price is: €230.00.

50ug 20% OFF + 230 loyalty points
Ser59–His645
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DARS2 Protein, N-His

Product name ARO-P12190-100
Uniprot ID Q6PI48
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH
Molecular weight 68.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser59-His645
Aliases /Synonyms DARS2, Aspartyl-tRNA synthetase, Aspartate--tRNA ligase, mitochondrial, AspRS
Reference ARO-P12190
Note For research use only.
Molecular Constructor
Ser59–His645
Product name ARO-P12190-1MG
Uniprot ID Q6PI48
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH
Molecular weight 68.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser59-His645
Aliases /Synonyms DARS2, Aspartyl-tRNA synthetase, Aspartate--tRNA ligase, mitochondrial, AspRS
Reference ARO-P12190
Note For research use only.
Molecular Constructor
Ser59–His645
Product name ARO-P12190-50
Uniprot ID Q6PI48
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH
Molecular weight 68.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser59-His645
Aliases /Synonyms DARS2, Aspartyl-tRNA synthetase, Aspartate--tRNA ligase, mitochondrial, AspRS
Reference ARO-P12190
Note For research use only.
Molecular Constructor
Ser59–His645

Introduction to Recombinant Human DARS2 Protein

Recombinant Human DARS2 Protein, also known as Aspartyl-tRNA synthetase 2, is a highly conserved enzyme that plays a crucial role in protein synthesis. This protein is encoded by the DARS2 gene and is found in both the cytoplasm and mitochondria of cells. It is involved in the process of attaching the amino acid aspartate to its corresponding transfer RNA (tRNA) molecule, which is essential for the accurate translation of genetic information into proteins.

Structure of Recombinant Human DARS2 Protein

The Recombinant Human DARS2 Protein is a 56 kDa protein consisting of 500 amino acids. It contains a highly conserved catalytic domain, which is responsible for attaching aspartate to tRNA, and a tRNA anticodon recognition domain, which ensures the specificity of the amino acid-tRNA pairing. The protein also has a C-terminal domain that is involved in the interaction with other proteins and regulatory factors.

The structure of Recombinant Human DARS2 Protein is similar to other aspartyl-tRNA synthetases found in both prokaryotic and eukaryotic organisms, with a characteristic Rossman fold and three conserved motifs. These motifs are essential for the binding of ATP, aspartate, and tRNA, respectively, and are critical for the catalytic activity of the enzyme.

Activity of Recombinant Human DARS2 Protein

The primary function of Recombinant Human DARS2 Protein is to catalyze the formation of aspartyl-tRNA, which is a crucial step in protein synthesis. This process involves the activation of aspartate, an amino acid, by attaching it to its corresponding tRNA molecule, which carries the genetic code for aspartate. This reaction is powered by the hydrolysis of ATP, which provides the necessary energy for the attachment of aspartate to tRNA.

In addition to its role in protein synthesis, Recombinant Human DARS2 Protein has been found to have other activities. It has been shown to have a protective effect against oxidative stress, which is a common cause of cell damage and aging. The protein has also been linked to the regulation of mitochondrial function and energy metabolism, making it an essential player in cellular homeostasis.

Applications of Recombinant Human DARS2 Protein

The production of Recombinant Human DARS2 Protein has numerous applications in both research and industrial settings. One of the primary uses of this protein is in the study of protein synthesis and translation. Its high specificity and activity make it a valuable tool for investigating the mechanisms of translation and the role of aspartyl-tRNA synthetase in this process.

Recombinant Human DARS2 Protein is also used in the development of diagnostic tests and vaccines. It can be used as an antigen in immunoassays to detect the presence of antibodies against the protein, which can be indicative of certain diseases or conditions. Additionally, the protein has shown potential as a vaccine candidate, as it can elicit an immune response and protect against oxidative stress and mitochondrial dysfunction.

Furthermore, Recombinant Human DARS2 Protein has potential therapeutic applications. Mutations in the DARS2 gene have been linked to neurological disorders such as leukoencephalopathy and Charcot-Marie-Tooth disease. The use of recombinant protein therapy, where the defective protein is replaced with a functional one, has shown promising results in treating these conditions.

Conclusion

Recombinant Human DARS2 Protein is a critical enzyme involved in protein synthesis and other cellular processes. Its structure, activity, and applications make it a valuable tool in scientific research and have potential therapeutic implications. Further studies on this protein and its role in cellular function may lead to a better understanding of its function and the development of novel treatments for various diseases and

Recombinant Human DARS2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DARS2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products