Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD16a/FCGR3A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P08637
Molecular weight:
24.13 kDa

Original price was: €269.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Gly17–Gln208
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD16a/FCGR3A Protein, N-His

Product name ARO-P10941-100
Uniprot ID P08637
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPP
Molecular weight 24.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly17-Gln208
Aliases /Synonyms CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference ARO-P10941
Note For research use only.
Molecular Constructor
Gly17–Gln208
Product name ARO-P10941-1MG
Uniprot ID P08637
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPP
Molecular weight 24.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly17-Gln208
Aliases /Synonyms CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference ARO-P10941
Note For research use only.
Molecular Constructor
Gly17–Gln208
Product name ARO-P10941-50
Uniprot ID P08637
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPP
Molecular weight 24.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly17-Gln208
Aliases /Synonyms CD16a, CD16A, FCGR3A, Fc-gamma RIII-alpha, FcRIIIa, IgG Fc receptor III-2, Low affinity immunoglobulin gamma Fc region receptor III-A, IGFR3, CD16a antigen, Fc-gamma RIII, FCGR3, Fc-gamma RIIIa, FCG3, FcRIII, FcR-10
Reference ARO-P10941
Note For research use only.
Molecular Constructor
Gly17–Gln208

Introduction

Recombinant Human CD16a/FCGR3A Protein, also known as Fc gamma receptor IIIa, is a glycoprotein that plays an important role in the immune system. It is a member of the Fc gamma receptor family, which are cell surface receptors that bind to the Fc region of immunoglobulins (antibodies). CD16a is primarily expressed on the surface of natural killer (NK) cells, as well as on a subset of macrophages and T cells. This protein has been extensively studied and has a wide range of applications in both research and clinical settings.

Structure of Recombinant Human CD16a/FCGR3A Protein

The CD16a protein is encoded by the FCGR3A gene located on chromosome 1 in humans. It is a transmembrane protein with a molecular weight of approximately 50 kDa. The extracellular region of CD16a contains two immunoglobulin-like domains, each with two subdomains (D1 and D2). These domains are responsible for binding to the Fc region of immunoglobulins. The intracellular region of CD16a contains an immunoreceptor tyrosine-based activation motif (ITAM), which is important for signal transduction.

Activity of Recombinant Human CD16a/FCGR3A Protein

The main function of CD16a is to mediate antibody-dependent cell-mediated cytotoxicity (ADCC). This process involves the binding of CD16a to the Fc region of antibodies that are bound to target cells. This triggers the activation of NK cells and macrophages, leading to the destruction of the target cells. CD16a is also involved in phagocytosis, the process by which immune cells engulf and destroy pathogens or other foreign particles. In addition, CD16a has been shown to play a role in cytokine production and cell proliferation.

Application of Recombinant Human CD16a/FCGR3A Protein

Recombinant Human CD16a/FCGR3A Protein has a wide range of applications in both research and clinical settings. In research, this protein is commonly used in studies related to the immune system, such as investigating the mechanisms of ADCC and phagocytosis. It is also used in studies on cancer immunotherapy, as CD16a is involved in the destruction of tumor cells. Additionally, CD16a is used in the development of therapeutic antibodies, as it is a key component in the mechanism of action of many antibody-based drugs.

In a clinical setting, CD16a is used as a biomarker for certain diseases and conditions. For example, decreased expression of CD16a on NK cells has been associated with autoimmune diseases such as systemic lupus erythematosus and rheumatoid arthritis. It is also used in the diagnosis and monitoring of certain types of cancer, such as chronic lymphocytic leukemia and multiple myeloma. Furthermore, CD16a is a target for immunotherapy in the treatment of cancer, as it can enhance the immune response against tumor cells.

Conclusion

In summary, Recombinant Human CD16a/FCGR3A Protein is a crucial component of the immune system, playing a key role in ADCC, phagocytosis, and cytokine production. Its structure, activity, and wide range of applications make it a valuable tool in both research and clinical settings. Further studies on this protein may lead to a better understanding of the immune response and the development of new immunotherapies for various diseases and conditions.

Recombinant Human CD16a/FCGR3A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD16a/FCGR3A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products