Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human BUB1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O43683
Molecular weight:
20.25 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
Met1–His151
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human BUB1 Protein, N-His

Product name ARO-P11255-100
Uniprot ID O43683
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTETH
Molecular weight 20.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His151
Aliases /Synonyms BUB1L, hBUB1, BUB1A, Mitotic checkpoint serine/threonine-protein kinase BUB1, BUB1
Reference ARO-P11255
Note For research use only.
Molecular Constructor
Met1–His151
Product name ARO-P11255-1MG
Uniprot ID O43683
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTETH
Molecular weight 20.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His151
Aliases /Synonyms BUB1L, hBUB1, BUB1A, Mitotic checkpoint serine/threonine-protein kinase BUB1, BUB1
Reference ARO-P11255
Note For research use only.
Molecular Constructor
Met1–His151
Product name ARO-P11255-50
Uniprot ID O43683
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTETH
Molecular weight 20.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His151
Aliases /Synonyms BUB1L, hBUB1, BUB1A, Mitotic checkpoint serine/threonine-protein kinase BUB1, BUB1
Reference ARO-P11255
Note For research use only.
Molecular Constructor
Met1–His151

Introduction to Recombinant Human BUB1 Protein

Recombinant Human BUB1 Protein, also known as BUB1B, is a highly conserved serine/threonine kinase that plays a crucial role in cell cycle regulation and mitosis. It is a key component of the spindle assembly checkpoint, which ensures the accurate distribution of chromosomes during cell division. BUB1 is expressed in all tissues and is essential for proper cell division and maintenance of genomic stability. In this article, we will explore the structure, activity, and applications of Recombinant Human BUB1 Protein.

Structure of Recombinant Human BUB1 Protein

Recombinant Human BUB1 Protein is a 116 kDa protein consisting of 1050 amino acids. It contains an N-terminal kinase domain, a central region with multiple repeats of a conserved motif known as the KEN box, and a C-terminal domain. The kinase domain is responsible for BUB1’s enzymatic activity, while the KEN box is involved in the regulation of protein degradation. The C-terminal domain is important for protein-protein interactions and is essential for BUB1’s function in the spindle assembly checkpoint.

Activity of Recombinant Human BUB1 Protein

Recombinant Human BUB1 Protein is a serine/threonine kinase that phosphorylates several target proteins involved in cell cycle regulation. It is a key component of the spindle assembly checkpoint, which monitors the attachment of chromosomes to the mitotic spindle. BUB1 acts as a sensor of kinetochore-microtubule attachment and prevents premature separation of sister chromatids during mitosis. It does so by phosphorylating the kinetochore protein, BUBR1, and the checkpoint kinase, CHK1, which in turn inhibits the anaphase-promoting complex/cyclosome (APC/C) and delays the onset of anaphase.

In addition to its role in the spindle assembly checkpoint, BUB1 also plays a role in the DNA damage response. It is involved in the activation of the tumor suppressor protein, p53, and the repair of DNA double-strand breaks. BUB1 also regulates the mitotic exit network, a signaling pathway that controls the exit from mitosis.

Applications of Recombinant Human BUB1 Protein

Recombinant Human BUB1 Protein has a wide range of applications in both basic research and drug discovery. It is commonly used as an antigen in the production of antibodies for research purposes. BUB1 antibodies are valuable tools for studying the function and regulation of this protein in various cellular processes.

BUB1 is also a potential therapeutic target for cancer treatment. Its overexpression has been observed in many types of cancer, and it has been linked to tumor progression and drug resistance. Inhibitors of BUB1 kinase activity have shown promising results in preclinical studies and are currently being evaluated in clinical trials for the treatment of various cancers.

Furthermore, BUB1 has been identified as a potential biomarker for cancer diagnosis and prognosis. Its expression levels have been correlated with tumor grade, stage, and patient survival in several types of cancer. Measurement of BUB1 levels in patient samples could aid in early detection and personalized treatment of cancer.

Conclusion

Recombinant Human BUB1 Protein is a crucial player in cell cycle regulation and mitosis. Its structure and activity make it an essential component of the spindle assembly checkpoint and the DNA damage response. This protein has various applications in research and drug discovery, and its potential as a therapeutic target and biomarker for cancer is currently being explored. Further studies on Recombinant Human BUB1 Protein will provide a better understanding of its function and potential for clinical use.

Recombinant Human BUB1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human BUB1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products