Name: Mouse Protein-arginine deiminase type-2 Mouse Recombinant Protein - GST-Tag
SKU: PX-P2083-10
Availability: InStock

Product name	Mouse Protein-arginine deiminase type-2 Mouse Recombinant Protein - GST-Tag
Uniprot ID	Q08642
Uniprot link	http://www.uniprot.org/uniprot/Q08642
Origin species	House Mouse
Expression system	Eukaryotic expression
Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDEFMQPPIRENMLRERTVRLQYGSRVEAVYVLGTQL
Molecular weight	102.7 kDa
Protein delivered with Tag?	Yes
Purity estimated	40%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Applications	ELISA,WB
Spec:NCBI Gene Aliases	mKIAA0994, Pdi2, Pdi
Spec:SwissProtID	Q08642
NCBI Reference	NP_032838.2
Aliases /Synonyms	Protein-arginine deiminase type-2 Mouse, peptidyl arginine deiminase, type II, Protein-arginine deiminase type-2 ou Peptidylarginine deiminase II ou Protein-arginine deiminase type II
Reference	PX-P2083
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Mouse Protein-arginine deiminase type-2 Mouse Recombinant Protein – GST-Tag”

size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Mouse Protein-arginine deiminase type-2 Mouse Recombinant Protein – GST-Tag