Name: Mouse Protein-arginine deiminase type-2 Mouse Recombinant Protein - GST-Tag
SKU: PX-P2083-10
Availability: InStock

Product name	Mouse Protein-arginine deiminase type-2 Mouse Recombinant Protein - GST-Tag
Uniprot ID	Q08642
Uniprot link	http://www.uniprot.org/uniprot/Q08642
Origin species	House Mouse
Expression system	Eukaryotic expression
Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDEFMQPPIRENMLRERTVRLQYGSRVEAVYVLGTQL
Molecular weight	102.7 kDa
Protein delivered with Tag?	Yes
Purity estimated	40%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Applications	ELISA,WB
Spec:NCBI Gene Aliases	mKIAA0994, Pdi2, Pdi
Spec:SwissProtID	Q08642
NCBI Reference	NP_032838.2
Aliases /Synonyms	Protein-arginine deiminase type-2 Mouse, peptidyl arginine deiminase, type II, Protein-arginine deiminase type-2 ou Peptidylarginine deiminase II ou Protein-arginine deiminase type II
Reference	PX-P2083
Note	For research use only

No Products found