Skip to main content

Mouse ENO1 Recombinant Protein

Reference:
Size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameMouse ENO1 Recombinant Protein
Uniprot IDP17182
Uniprot linkhttp://www.uniprot.org/uniprot/P17182
Origin speciesHouse Mouse
Expression systemProkaryotic expression
SequenceMGHHHHHHHHHHSSGHIEGRHMMSILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFM GKGVSQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLA GNPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNIL ENKEALELLKTAIAKAGYTDQVVIGMDVAASEFYRSGKYDLDFKSPDDPSRYITPDQLADLYKSFVQNYPVVSIEDPFDQ DDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAASEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETED TFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKAKFAGRSFRNPLAKDYLDDDDL
Molecular weight50,68 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, pH 7.5
FormFrozen
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypeFull-length
Protein AccessionNP_075608
Spec:Entrez GeneID13806
Spec:NCBI Gene AliasesMBP-1, AL022784, 0610008I15, Eno-1
Spec:SwissProtIDP17182
NCBI ReferenceNP_075608
Aliases /SynonymsENO1 Protein, Alpha Enolase Protein, Alpha enolase like 1 Protein, ENO1L1 Protein, Enolase 1 Protein, MBP-1 Protein, MBPB1 Protein, MPB1 Protein, MYC promoter-binding protein 1 Protein, NNE Protein, Phosphopyruvate hydratase Protein, Alpha-enolase Protein, Tau-crystallin Protein, MBP1 Protein, MPB-1 Protein, C-myc promoter-binding protein Protein, Enolase 1, (alpha) Protein, Enolase-alpha Protein, Non-neural enolase Protein, Plasminogen-binding protein Protein, PPH Protein
ReferencePX-P1088
NoteFor research use only

Description of Mouse ENO1 Recombinant Protein

General information on Mouse ENO1 Recombinant Protein:

Enolase 1 (ENO1), commonly known as alpha-enolase is a glycolytic enzyme, one of three enolase isoenzymes found in mammals. Every isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. ENO1 is a glycolytic enzyme that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate. This isozyme is ubiquitously expressed in adult human tissues, including liver, brain, kidney, and spleen. It is a multifunctional enzyme that plays a part in the glycolysis and in various processes such as growth control, hypoxia tolerance and allergic responses. It can also work in the intravascular and pericellular fibrinolytic system because to its capability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons.

Publication

  • 1: Guillou C, Derambure C, Fréret M, Verdet M, Avenel G, Golinski ML, Sabourin JC, Le Loarer F, Adriouch S, Boyer O, Lequerré T, Vittecoq O. Prophylactic Injection of Recombinant Alpha-Enolase Reduces Arthritis Severity in the Collagen-Induced Arthritis Mice Model. PLoS One. 2015 Aug 24;10(8):e0136359. doi: 10.1371/journal.pone.0136359. eCollection 2015. PubMed PMID: 26302382; PubMed Central PMCID: PMC4547710.
  • 2: Sousa LP, Silva BM, Brasil BS, Nogueira SV, Ferreira PC, Kroon EG, Kato K, Bonjardim CA. Plasminogen/plasmin regulates alpha-enolase expression through the MEK/ERK pathway. Biochem Biophys Res Commun. 2005 Dec 2;337(4):1065-71. Epub 2005 Oct 4. PubMed PMID: 16225843.
  • 3: Lopez-Alemany R, Suelves M, Diaz-Ramos A, Vidal B, Munoz-Canoves P. Alpha-enolase plasminogen receptor in myogenesis. Front Biosci. 2005 Jan 1;10:30-6. Print 2005 Jan 1. Review. PubMed PMID: 15574344.
  • 4: López-Alemany R, Suelves M, Muñoz-Cánoves P. Plasmin generation dependent on alpha-enolase-type plasminogen receptor is required for myogenesis. Thromb Haemost. 2003 Oct;90(4):724-33. PubMed PMID: 14515195.
  • 5: Couldrey C, Carlton MB, Ferrier J, Colledge WH, Evans MJ. Disruption of murine alpha-enolase by a retroviral gene trap results in early embryonic lethality. Dev Dyn. 1998 Jun;212(2):284-92. PubMed PMID: 9626503.
  • 6: Bottalico LA, Kendrick NC, Keller A, Li Y, Tabas I. Cholesteryl ester loading of mouse peritoneal macrophages is associated with changes in the expression or modification of specific cellular proteins, including increase in an alpha-enolase isoform. Arterioscler Thromb. 1993 Feb;13(2):264-75. PubMed PMID: 8427861.
  • 7: Mutze K, Vierkotten S, Milosevic J, Eickelberg O, Königshoff M. Enolase 1 (ENO1) and protein disulfide-isomerase associated 3 (PDIA3) regulate Wnt/β-catenin-driven trans-differentiation of murine alveolar epithelial cells. Dis Model Mech. 2015 Aug 1;8(8):877-90. doi: 10.1242/dmm.019117. Epub 2015 May 14. PubMed PMID: 26035385; PubMed Central PMCID: PMC4527283.
  • 8: Bae S, Kim H, Lee N, Won C, Kim HR, Hwang YI, Song YW, Kang JS, Lee WJ. α-Enolase expressed on the surfaces of monocytes and macrophages induces robust synovial inflammation in rheumatoid arthritis. J Immunol. 2012 Jul 1;189(1):365-72. doi: 10.4049/jimmunol.1102073. Epub 2012 May 23. PubMed PMID: 22623332.
  • 9: Ryu SY, Hong GU, Kim DY, Ro JY. Enolase 1 and calreticulin regulate the differentiation and function of mouse mast cells. Cell Signal. 2012 Jan;24(1):60-70. doi: 10.1016/j.cellsig.2011.07.011. Epub 2011 Jul 23. PubMed PMID: 21803152.
  • 10: Wang J, Gu Y, Wang L, Hang X, Gao Y, Wang H, Zhang C. HUPO BPP pilot study: a proteomics analysis of the mouse brain of different developmental stages. Proteomics. 2007 Nov;7(21):4008-15. PubMed PMID: 17922513.
  • 11: Keller A, Demeurie J, Merkulova T, Géraud G, Cywiner-Golenzer C, Lucas M, Châtelet FP. Fibre-type distribution and subcellular localisation of alpha and beta enolase in mouse striated muscle. Biol Cell. 2000 Oct;92(7):527-35. PubMed PMID: 11229603.
  • 12: Merkulova T, Lucas M, Jabet C, Lamandé N, Rouzeau JD, Gros F, Lazar M, Keller A. Biochemical characterization of the mouse muscle-specific enolase: developmental changes in electrophoretic variants and selective binding to other proteins. Biochem J. 1997 May 1;323 ( Pt 3):791-800. PubMed PMID: 9169614; PubMed Central PMCID: PMC1218384.
  • 13: Lazar M, Lucas M, Lamandé N, Bishop JG, Gros F, Legault-Demare L. Isolation of murine neuron-specific and non-neuronal enolase cDNA clones. Biochem Biophys Res Commun. 1986 Nov 26;141(1):271-7. PubMed PMID: 3801001.
  • 14: Kaghad M, Dumont X, Chalon P, Lelias JM, Lamandé N, Lucas M, Lazar M, Caput D. Nucleotide sequences of cDNAs alpha and gamma enolase mRNAs from mouse brain. Nucleic Acids Res. 1990 Jun 25;18(12):3638. PubMed PMID: 2362815; PubMed Central PMCID: PMC331026.
  • 15: Barbieri G, De Angelis L, Feo S, Cossu G, Giallongo A. Differential expression of muscle-specific enolase in embryonic and fetal myogenic cells during mouse development. Differentiation. 1990 Dec;45(3):179-84. PubMed PMID: 2090519.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Mouse ENO1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products