Name: Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein
SKU: PX-P4045-10
Availability: InStock

Product name	Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein
Uniprot ID	Q7Z7D3
Uniprot link	http://www.uniprot.org/uniprot/Q7Z7D3
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MASLGQILFWSIISIIIILAGAIAFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAGSHHHHHH
Molecular weight	28.73kDa
Protein delivered with Tag?	Yes
Purity estimated	70%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Partial
Aliases /Synonyms	B7-H4, B7H4, B7S1, B7X, B7h.5, VCTN1, T-cell costimulatory molecule B7x, Immune costimulatory protein B7-H4, VTCN1
Reference	PX-P4045
Note	For research use only

No Products found