Contact Book a call
+33 (0)3 90 20 54 70
Contact Book a call
Contact Book a call
Nycodenz AG® Nycodenz AG® XtenCHO ™ Starter kit XtenCHO ™ Starter kit
View all Products

Human PARP1 Recombinant Protein

Reference:
Product Image
SDS-PAGE for Human PARP1 Recombinant Protein
Size

100ug, 50ug
Brand

Product type

Host Species

Applications

,

Tags:
Specification
Documents
QC & Validation Data1
Publications
Reviews
Product nameHuman PARP1 Recombinant Protein
Uniprot IDP09874
Uniprot linkhttp://www.uniprot.org/uniprot/P09874
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLDDDDKGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESA ILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFP PETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEK MNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINK SEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGS NKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFD VESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSV QAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFK IEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGL ILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVN LKYLLKLKFNFKTSLW
Molecular weight90,90 kDa
Purity estimated60%
BufferPBS, imidazole 300mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days2-3
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypePartial
Protein AccessionAAB59447.1
Spec:Entrez GeneID142
Spec:NCBI Gene AliasesPPOL, ADPRT, ARTD1, PARP-1, ADPRT 1, PARP, ADPRT1, pADPRT-1
Spec:SwissProtIDP09874
NCBI ReferenceAAB59447.1
Aliases /SynonymsPARP1, poly(ADP-ribose) synthetase, PARP-1, ADP-ribosyltransferase diphtheria toxin-like 1, ARTD1, NAD(+) ADP-ribosyltransferase 1, ADPRT 1, Poly[ADP-ribose] synthase 1, ADPRT, PPOL
ReferencePX-P1137
NoteFor research use only
Datasheet Download
MSDS Download

SDS-PAGE for Human PARP1 Recombinant Protein

Human PARP1 Recombinant Protein on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the protein antibody is superior than 90 %.

Publication

  • 1: Sander Effron S, Makvandi M, Lin L, Xu K, Li S, Lee H, Hou C, Pryma DA, Koch C, Mach RH. PARP-1 Expression Quantified by [(18)F]FluorThanatrace: A Biomarker of Response to PARP Inhibition Adjuvant to Radiation Therapy. Cancer Biother Radiopharm. 2017 Feb;32(1):9-15. doi: 10.1089/cbr.2016.2133. Epub 2017 Jan 24. PubMed PMID: 28118040; PubMed Central PMCID: PMC5312613.
  • 2: Cui NH, Qiao C, Chang XK, Wei L. Associations of PARP-1 variant rs1136410 with PARP activities, oxidative DNA damage, and the risk of age-related cataract in a Chinese Han population: A two-stage case-control analysis. Gene. 2017 Feb 5;600:70-76. doi: 10.1016/j.gene.2016.11.019. Epub 2016 Nov 10. PubMed PMID: 27840165.
  • 3: Alhadheq AM, Purusottapatnam Shaik J, Alamri A, Aljebreen AM, Alharbi O, Almadi MA, Alhadeq F, Azzam NA, Semlali A, Alanazi M, Bazzi MD, Reddy Parine N. The Effect of Poly(ADP-ribose) Polymerase-1 Gene 3'Untranslated Region Polymorphism in Colorectal Cancer Risk among Saudi Cohort. Dis Markers. 2016;2016:8289293. Epub 2016 Sep 25. PubMed PMID: 27746584; PubMed Central PMCID: PMC5055945.
  • 4: Li S, Cui Z, Meng X. Knockdown of PARP-1 Inhibits Proliferation and ERK Signals, Increasing Drug Sensitivity in Osteosarcoma U2OS Cells. Oncol Res. 2016;24(4):279-86. doi: 10.3727/096504016X14666990347554. PubMed PMID: 27656839.
  • 5: Anil S, Gopikrishnan PB, Basheer AB, Vidyullatha BG, Alogaibi YA, Chalisserry EP, Javed F, Dalati MH, Vellappally S, Hashem MI, Divakar DD. Association of Poly (ADP-Ribose) Polymerase 1 Variants with Oral Squamous Cell Carcinoma Susceptibility in a South Indian Population. Asian Pac J Cancer Prev. 2016;17(8):4107-11. PubMed PMID: 27644669.
  • 6: Mishra D, Singh S, Narayan G. Curcumin Induces Apoptosis in Pre-B Acute Lymphoblastic Leukemia Cell Lines Via PARP-1 Cleavage. Asian Pac J Cancer Prev. 2016;17(8):3865-9. PubMed PMID: 27644631.
  • 7: Gallo M, Cacheux V, Vincent L, Bret C, Tempier A, Guittard C, Macé A, Leventoux N, Costes V, Szablewski V. Leukemic non-nodal mantle cell lymphomas have a distinct phenotype and are associated with deletion of PARP1 and 13q14. Virchows Arch. 2016 Dec;469(6):697-706. Epub 2016 Sep 7. PubMed PMID: 27605053.
  • 8: Jubin T, Kadam A, Jariwala M, Bhatt S, Sutariya S, Gani AR, Gautam S, Begum R. The PARP family: insights into functional aspects of poly (ADP-ribose) polymerase-1 in cell growth and survival. Cell Prolif. 2016 Aug;49(4):421-37. doi: 10.1111/cpr.12268. Epub 2016 Jun 22. Review. PubMed PMID: 27329285.
  • 9: Nogueira A, Assis J, Faustino I, Pereira D, Catarino R, Medeiros R. Base excision repair pathway: PARP1 genotypes as modulators of therapy response in cervical cancer patients. Biomarkers. 2017 Feb;22(1):70-76. doi: 10.1080/1354750X.2016.1204006. Epub 2016 Jul 6. PubMed PMID: 27323894.
  • 10: Wang L, Liu F, Jiang N, Zhou W, Zhou X, Zheng Z. Design, Synthesis, and Biological Evaluation of Novel PARP-1 Inhibitors Based on a 1H-Thieno[3,4-d] Imidazole-4-Carboxamide Scaffold. Molecules. 2016 Jun 13;21(6). pii: E772. doi: 10.3390/molecules21060772. PubMed PMID: 27304949.
  • 11: Gibson BA, Zhang Y, Jiang H, Hussey KM, Shrimp JH, Lin H, Schwede F, Yu Y, Kraus WL. Chemical genetic discovery of PARP targets reveals a role for PARP-1 in transcription elongation. Science. 2016 Jul 1;353(6294):45-50. doi: 10.1126/science.aaf7865. Epub 2016 Jun 2. PubMed PMID: 27256882.
  • 12: Zeng J, Libien J, Shaik F, Wolk J, Hernández AI. Nucleolar PARP-1 Expression Is Decreased in Alzheimer's Disease: Consequences for Epigenetic Regulation of rDNA and Cognition. Neural Plast. 2016;2016:8987928. doi: 10.1155/2016/8987928. Epub 2016 Feb 29. PubMed PMID: 27034851; PubMed Central PMCID: PMC4789469.
  • 13: Li Z, Lv T, Liu Y, Huang X, Qiu Z, Li J. PARP1 is a novel independent prognostic factor for the poor prognosis of chordoma. Cancer Biomark. 2016 Mar 18;16(4):633-9. doi: 10.3233/CBM-160605. PubMed PMID: 27002766.
  • 14: Salluzzo MG, Cosentino FI, Romano C, Scillato F, Morale MC, Rando RG, Elia F, Spada RS, Bosco P, Salemi M. Poly (ADP-ribose) polymerase-1 (PARP-1) -410C/T polymorphism in Sicilian patients with Parkinson's disease. J Neurol Sci. 2016 Apr 15;363:95-6. doi: 10.1016/j.jns.2016.02.039. Epub 2016 Feb 17. PubMed PMID: 27000229.
  • 15: Deben C, Lardon F, Wouters A, Op de Beeck K, Van den Bossche J, Jacobs J, Van Der Steen N, Peeters M, Rolfo C, Deschoolmeester V, Pauwels P. APR-246 (PRIMA-1(MET)) strongly synergizes with AZD2281 (olaparib) induced PARP inhibition to induce apoptosis in non-small cell lung cancer cell lines. Cancer Lett. 2016 Jun 1;375(2):313-22. doi: 10.1016/j.canlet.2016.03.017. Epub 2016 Mar 11. PubMed PMID: 26975633.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human PARP1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products