Name: Human Myoglobin recombinant protein
SKU: PX-P4024-10
Availability: InStock

Product name	Human Myoglobin recombinant protein
Uniprot ID	P02144
Uniprot link	http://www.uniprot.org/uniprot/P02144
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQGSHHHHHH
Molecular weight	18.06kDa
Purity estimated	70%
Buffer	50 mM Tris-HCl pH 7.5, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Full-length
Aliases /Synonyms	myoglobin, PVALB, MB, MGC13548
Reference	PX-P4024
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human Myoglobin recombinant protein”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PX-P4024 210€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.