Clostridium Cwp84 Recombinant Protein
| Size | 10ug, 100ug |
|---|---|
| Brand | |
| Product type | |
| Host Species |
Category:Recombinant Proteins
| Product name | Clostridium Cwp84 Recombinant Protein |
|---|---|
| Uniprot ID | Q183M1 |
| Uniprot link | http://www.uniprot.org/uniprot/Q183M1 |
| Origin species | Clostridium |
| Expression system | Procaryotic expression |
| Sequence | MGSSHHHHHHSSGLVPRGSHMASAENHKTLDGVETAEYSESYLQYLEDVKNGDTAKYNGVIPFPHEMEGTTLRNKGRSSL PSAYKSSVAYNPMDLGLTTPAKNQGSLNTCWSFSGMSTLEAYLKLKGYGTYDLSEEHLRWWATGGKYGWNLDDMSGSSNV TAIGYLTAWAGPKLEKDIPYNLKSEAQGATKPSNMDTAPTQFNVTDVVRLNKDKETVKNAIMQYGSVTSGYAHYSTYFNK DETAYNCTNKRAPLNHAVAIVGWDDNYSKDNFASDVKPESNGAWLVKSSWGEFNSMKGFFWISYEDKTLLTDTDNYAMKS VSKPDSDKKMYQLEYAGLSKIMSNKVTAANVFDFSRDSEKLDSVMFETDSVGAKYEVYYAPVVNGVPQNNSMTKLASGTV SYSGYINVPTNSYSLPKGKGAIVVVIDNTANPNREKSTLAYETNIDAYYLYEAKANLGESYILQNNKFEDINTYSEFSPC NFVIKAITKTSSGQATSGESLTGADRYETAVKVSQKGWTSSQNAVLVNGDAIVDALTATPFTAAIDSPILLTGKDNLDSK TKAELQRLGTKKVYLIGGENSLSKNVQTQLSNMGISVERISGSDRYKTSISLAQKLNSIKSVSQVAVANGVNGLADAISV GAAAADNNMPIILTNEKSELQGADEFLNSSKITKSYIIGGTATLSSNLESKLSNPTRLAGSNRNETNAKIIDKFYPSSDL KYAFVVKDGSKSQGDLIDGLAVGALGAKTDSPVVLVGNKLDESQKNVLKSKKIETPIRVGGNGNESAFNELNTLLGK |
| Molecular weight | 83,36 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 60% |
| Buffer | PBS, imidazole 300mM |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | YP_001089300.1 |
| Spec:Entrez GeneID | 4915160 |
| Spec:SwissProtID | Q183M1 |
| NCBI Reference | YP_001089300.1 |
| Aliases /Synonyms | Cwp84, cell surface-associated cysteine protease, CD630_27870 |
| Reference | PX-P1083 |
| Publications | 1: Bradshaw WJ, Roberts AK, Shone CC, Acharya KR. Cwp84, a Clostridium difficile cysteine protease, exhibits conformational flexibility in the absence of its propeptide. Acta Crystallogr F Struct Biol Commun. 2015 Mar;71(Pt 3):295-303. doi: 10.1107/S2053230X15001065. Epub 2015 Feb 19. PubMed PMID: 25760704; PubMed Central PMCID: PMC4356305. 2: ChapetónMontes D, Candela T, Collignon A, Janoir C. Localization of the Clostridium difficile cysteine protease Cwp84 and insights into its maturation process. J Bacteriol. 2011 Oct;193(19):5314-21. doi: 10.1128/JB.00326-11. Epub 2011 Jul 22. PubMed PMID: 21784932; PubMed Central PMCID: PMC3187449. 3: de la Riva L, Willing SE, Tate EW, Fairweather NF. Roles of cysteine proteases Cwp84 and Cwp13 in biogenesis of the cell wall of Clostridium difficile. J Bacteriol. 2011 Jul;193(13):3276-85. doi: 10.1128/JB.00248-11. Epub 2011 Apr 29. PubMed PMID: 21531808; PubMed Central PMCID: PMC3133288. 4: Pantaléon V, Soavelomandroso AP, Bouttier S, Briandet R, Roxas B, Chu M, Collignon A, Janoir C, Vedantam G, Candela T. The Clostridium difficile Protease Cwp84 Modulates both Biofilm Formation and Cell-Surface Properties. PLoS One. 2015 Apr 29;10(4):e0124971. doi: 10.1371/journal.pone.0124971. eCollection 2015. PubMed PMID: 25922949; PubMed Central PMCID: PMC4414356. 5: Dannheim H, Riedel T, Neumann-Schaal M, Bunk B, Schober I, Spröer C, Chibani CM, Gronow S, Liesegang H, Overmann J, Schomburg D. Manual curation and reannotation of the genomes of Clostridium difficile 630Δerm and C. difficile 630. J Med Microbiol. 2017 Mar;66(3):286-293. doi: 10.1099/jmm.0.000427. PubMed PMID: 28357980. 6: Monot M, Boursaux-Eude C, Thibonnier M, Vallenet D, Moszer I, Medigue C, Martin-Verstraete I, Dupuy B. Reannotation of the genome sequence of Clostridium difficile strain 630. J Med Microbiol. 2011 Aug;60(Pt 8):1193-9. doi: 10.1099/jmm.0.030452-0. Epub 2011 Feb 24. PubMed PMID: 21349987. 7: Sebaihia M, Wren BW, Mullany P, Fairweather NF, Minton N, Stabler R, Thomson NR, Roberts AP, Cerdeño-Tárraga AM, Wang H, Holden MT, Wright A, Churcher C, Quail MA, Baker S, Bason N, Brooks K, Chillingworth T, Cronin A, Davis P, Dowd L, Fraser A, Feltwell T, Hance Z, Holroyd S, Jagels K, Moule S, Mungall K, Price C, Rabbinowitsch E, Sharp S, Simmonds M, Stevens K, Unwin L, Whithead S, Dupuy B, Dougan G, Barrell B, Parkhill J. The multidrug-resistant human pathogen Clostridium difficile has a highly mobile, mosaic genome. Nat Genet. 2006 Jul;38(7):779-86. Epub 2006 Jun 25. PubMed PMID: 16804543. |
| Note | For research use only |
General information on Clostridium Cwp84 Recombinant Protein:
Cwp84 is a Clostridium. difficile surface protein that has recently been shown to possess cysteine protease activity and which is highly immunogenic in patients with C. difficile-associated disease and is likely implicated in the pathogenic process and may have a role in the degradation of extracellular matrices. This enzyme, which appears to be displayed on the bacterial cell surface, exhibited degrading activity against fibronectin, laminin, and vitronectin. Cwp84 plays also a role in maturation of SlpA.
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.