Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD158j / KIR2DS2, C-Fc, recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P43631
Molecular weight:
53.26 kDa

420.00

100ug + 420 loyalty points
Met1–His245 Fc
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD158j / KIR2DS2, C-Fc, recombinant protein

Product name CD158j / KIR2DS2, C-Fc, recombinant protein
Uniprot ID P43631
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Molecular weight 53.26 kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-His245
Protein Accession P43631
Reference PX-P5578
Note For research use only
Molecular Constructor
Met1–His245 Fc

CD158j / KIR2DS2, C-Fc, recombinant protein

There are no reviews yet.

Be the first to review “CD158j / KIR2DS2, C-Fc, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products