Name: Angiopoietin-related protein 3(Angptl3)
SKU: PX-P4758-10
Availability: InStock

Product name	Angiopoietin-related protein 3(Angptl3)
Uniprot ID	Q9R182
Uniprot link	https://www.uniprot.org/uniprot/Q9R182
Expression system	Prokaryotic expression
Sequence	MGSSHHHHHHSSGLVPRGSHMSRVDPDLSSFDSAPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLRTNEIKEEEKELRRTTSTLQVKNEEVKNMSVELNSKLESLLEEKTALQHKVRALEEQLTNLILSPAGAQEHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHMQIKEIEKQLRKTGIQEPSENSLSSKSRAPR
Molecular weight	26.08kDa
Purity estimated	>80% by SDS-PAGE
Buffer	PBS, pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Ser17-Arg224
Aliases /Synonyms	Angiopoietin-like protein 3
Reference	PX-P4758
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Angiopoietin-related protein 3(Angptl3)”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PX-TA1369 400€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.