Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Evinacumab Biosimilar – Anti-ANGPTL3 mAb – Research Grade

  • PX-TA1369-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €183.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Evinacumab Biosimilar - Anti-ANGPTL3 mAb - Research Grade

Product name Evinacumab Biosimilar - Anti-ANGPTL3 mAb - Research Grade
Uniprot ID Q9Y5C1
Source CAS 1446419-85-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Evinacumab,REGN 1500,ANGPTL3,anti-ANGPTL3
Reference PX-TA1369
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Evinacumab Biosimilar - Anti-ANGPTL3 mAb - Research Grade
Uniprot ID Q9Y5C1
Source CAS 1446419-85-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Evinacumab,REGN 1500,ANGPTL3,anti-ANGPTL3
Reference PX-TA1369
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1369-50
Uniprot ID Q9Y5C1
Source CAS 1446419-85-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Evinacumab,REGN 1500,ANGPTL3,anti-ANGPTL3
Reference PX-TA1369
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

General information on Anti-ANGPTL3[Homo sapiens] (Evinacumab) Monoclonal Antibody

Evinacumab is a recombinant human IgG4 monoclonal antibody targeting human angiopoietin-like protein 3 (ANGPTL3). The ANGPTL protein family has many physiological functions-including the regulation of lipid metabolism. It has been noted that the loss-of-function mutation of ANGPTL3 leads to hypolipidemia and subsequently reduces cardiovascular risk, while increased function seems to be related to cardiovascular risk. Evinacumab has been used to treat homozygous familial hypercholesterolemia (HoFH). It has been sold under the Evkeeza brand name.

SDS-PAGE for Evinacumab Biosimilar - Anti-ANGPTL3 mAb

SDS-PAGE for Evinacumab Biosimilar - Anti-ANGPTL3 mAb

Evinacumab Biosimilar - Anti-ANGPTL3 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Evinacumab Biosimilar - Anti-ANGPTL3 mAb - Research Grade

SEC-HPLC of Evinacumab Biosimilar - Anti-ANGPTL3 mAb - Research Grade

Evinacumab Biosimilar - Anti-ANGPTL3 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Evinacumab Biosimilar - Anti-ANGPTL3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Evinacumab Biosimilar – Anti-ANGPTL3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products