Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

A. thaliana HSP17 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
A. thaliana
Uniprot ID:
P19036
Molecular weight:
19,11 kDa

210.00

50ug + 210 loyalty points
Full-length Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

A. thaliana HSP17 Recombinant Protein

Product name A. thaliana HSP17 Recombinant Protein
Uniprot ID P19036
Uniprot link http://www.uniprot.org/uniprot/P19036
Origin species A. thaliana
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLPRAMSLVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAPAKDVAAFTNAKVDWRETPEAHVFKADV PGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASMENGVLSVTVPKVQESK PEVKSVDISG
Molecular weight 19,11 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 250mM, Urea 4M, pH 8.0
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_190209.1
Spec:Entrez GeneID 823768
Spec:NCBI Gene Aliases ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4, SMALL HEAT-SHOCK PROTEIN 17.4, ATHSP17.4
Spec:SwissProtID P19036
NCBI Reference NP_190209.1
Aliases /Synonyms HSP17, heat shock protein 17.4, 17.4 kDa class I heat shock protein, 17.4 kDa heat shock protein 1, AtHsp17.4A
Reference PX-P1065
Note For research use only
Molecular Constructor
Full-length Yes
Product name A. thaliana HSP17 Recombinant Protein
Uniprot ID P19036
Uniprot link http://www.uniprot.org/uniprot/P19036
Origin species A. thaliana
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLPRAMSLVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAPAKDVAAFTNAKVDWRETPEAHVFKADV PGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASMENGVLSVTVPKVQESK PEVKSVDISG
Molecular weight 19,11 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 250mM, Urea 4M, pH 8.0
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_190209.1
Spec:Entrez GeneID 823768
Spec:NCBI Gene Aliases ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4, SMALL HEAT-SHOCK PROTEIN 17.4, ATHSP17.4
Spec:SwissProtID P19036
NCBI Reference NP_190209.1
Aliases /Synonyms HSP17, heat shock protein 17.4, 17.4 kDa class I heat shock protein, 17.4 kDa heat shock protein 1, AtHsp17.4A
Reference PX-P1065
Note For research use only
Molecular Constructor
Full-length Yes

General information on A. thaliana HSP17 Recombinant Protein:

Recombinant human HSP17, also known as Heat Shock 17.4 kDa class I heat shock protein. Heat shock proteins (HSP) are a family of proteins that are produced by cells in reaction to exposure to stressful environment. They can be expressed during exposure heat shock, to cold, UV light, and during wound healing or tissue remodeling. A lot of members from this group perform chaperone function by stabilizing new proteins to ensure correct folding or by helping to refold proteins that were damaged by the cell stress. This increase in expression is transcriptionally regulated.

  • Wehmeyer N, Hernandez LD, Finkelstein RR, Vierling E. Synthesis of small heat-shock proteins is part of the developmental program of late seed maturation. Plant Physiol. 1996 Oct;112(2):747-57. PubMed PMID: 8883386; PubMed Central PMCID: PMC157999.
  • Kim DH, Xu ZY, Na YJ, Yoo YJ, Lee J, Sohn EJ, Hwang I. Small heat shock protein Hsp17.8 functions as an AKR2A cofactor in the targeting of chloroplast outer membrane proteins in Arabidopsis. Plant Physiol. 2011 Sep;157(1):132-46. doi: 10.1104/pp.111.178681. Epub 2011 Jul 5. PubMed PMID: 21730198; PubMed Central PMCID: PMC3165864.
  • Dortay H, Gruhn N, Pfeifer A, Schwerdtner M, Schmülling T, Heyl A. Toward an interaction map of the two-component signaling pathway of Arabidopsis thaliana. J Proteome Res. 2008 Sep;7(9):3649-60. doi: 10.1021/pr0703831. Epub 2008 Jul 22. PubMed PMID: 18642946.
  • Salanoubat M, Lemcke K, Rieger M, Ansorge W, Unseld M, Fartmann B, Valle G, Blöcker H, Perez-Alonso M, Obermaier B, Delseny M, Boutry M, Grivell LA, Mache R, Puigdomènech P, De Simone V, Choisne N, Artiguenave F, Robert C, Brottier P, Wincker P, Cattolico L, Weissenbach J, Saurin W, Quétier F, Schäfer M, Müller-Auer S, Gabel C, Fuchs M, Benes V, Wurmbach E, Drzonek H, Erfle H, Jordan N, Bangert S, Wiedelmann R, Kranz H, Voss H, Holland R, Brandt P, Nyakatura G, Vezzi A, D'Angelo M, Pallavicini A, Toppo S, Simionati B, Conrad A, Hornischer K, Kauer G, Löhnert TH, Nordsiek G, Reichelt J, Scharfe M, Schön O, Bargues M, Terol J, Climent J, Navarro P, Collado C, Perez-Perez A, Ottenwälder B, Duchemin D, Cooke R, Laudie M, Berger-Llauro C, Purnelle B, Masuy D, de Haan M, Maarse AC, Alcaraz JP, Cottet A, Casacuberta E, Monfort A, Argiriou A, flores M, Liguori R, Vitale D, Mannhaupt G, Haase D, Schoof H, Rudd S, Zaccaria P, Mewes HW, Mayer KF, Kaul S, Town CD, Koo HL, Tallon LJ, Jenkins J, Rooney T, Rizzo M, Walts A, Utterback T, Fujii CY, Shea TP, Creasy TH, Haas B, Maiti R, Wu D, Peterson J, Van Aken S, Pai G, Militscher J, Sellers P, Gill JE, Feldblyum TV, Preuss D, Lin X, Nierman WC, Salzberg SL, White O, Venter JC, Fraser CM, Kaneko T, Nakamura Y, Sato S, Kato T, Asamizu E, Sasamoto S, Kimura T, Idesawa K, Kawashima K, Kishida Y, Kiyokawa C, Kohara M, Matsumoto M, Matsuno A, Muraki A, Nakayama S, Nakazaki N, Shinpo S, Takeuchi C, Wada T, Watanabe A, Yamada M, Yasuda M, Tabata S; European Union Chromosome 3 Arabidopsis Sequencing Consortium.; Institute for Genomic Research.; Kazusa DNA Research Institute.. Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana. Nature. 2000 Dec 14;408(6814):820-2. PubMed PMID: 11130713.

There are no reviews yet.

Be the first to review “A. thaliana HSP17 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products