Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CCL11/Eotaxin Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P48298
Molecular weight:
20.78 kDa

Original price was: €299.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
His24–Pro97
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CCL11/Eotaxin Protein, N-His-SUMO

Product name ARO-P10580-100
Uniprot ID P48298
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Molecular weight 20.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His24-Pro97
Aliases /Synonyms Small-inducible cytokine A11, SCYA11, Eotaxin, CCL11, Eosinophil chemotactic protein, C-C motif chemokine 11
Reference ARO-P10580
Note For research use only.
Molecular Constructor
His24–Pro97
Product name ARO-P10580-1MG
Uniprot ID P48298
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Molecular weight 20.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His24-Pro97
Aliases /Synonyms Small-inducible cytokine A11, SCYA11, Eotaxin, CCL11, Eosinophil chemotactic protein, C-C motif chemokine 11
Reference ARO-P10580
Note For research use only.
Molecular Constructor
His24–Pro97
Product name ARO-P10580-50
Uniprot ID P48298
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Molecular weight 20.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His24-Pro97
Aliases /Synonyms Small-inducible cytokine A11, SCYA11, Eotaxin, CCL11, Eosinophil chemotactic protein, C-C motif chemokine 11
Reference ARO-P10580
Note For research use only.
Molecular Constructor
His24–Pro97

Introduction to Recombinant Mouse CCL11/Eotaxin Protein

Recombinant Mouse CCL11/Eotaxin Protein, also known as Eotaxin-1, is a cytokine belonging to the CC chemokine family. It is produced by various cell types, including epithelial cells, fibroblasts, and macrophages, in response to inflammatory stimuli. This protein plays a crucial role in the recruitment and activation of eosinophils, a type of white blood cell involved in allergic reactions and parasitic infections. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse CCL11/Eotaxin Protein.

Structure of Recombinant Mouse CCL11/Eotaxin Protein

Recombinant Mouse CCL11/Eotaxin Protein is a small protein consisting of 74 amino acids with a molecular weight of approximately 8.5 kDa. It is produced by recombinant DNA technology in a variety of expression systems, including bacteria, yeast, and mammalian cells. The recombinant protein is then purified to remove any impurities, ensuring a high-quality and biologically active product.

The crystal structure of Recombinant Mouse CCL11/Eotaxin Protein has been determined, revealing a monomeric structure with a characteristic three-dimensional fold of CC chemokines. It consists of a three-stranded anti-parallel beta-sheet and a C-terminal alpha-helix, connected by three disulfide bonds. These structural features are essential for the biological activity of the protein.

Activity of Recombinant Mouse CCL11/Eotaxin Protein

Recombinant Mouse CCL11/Eotaxin Protein acts as a chemoattractant for eosinophils, monocytes, and T cells by binding to its specific receptor, CCR3. This binding triggers a cascade of signaling events, leading to the migration of these immune cells to the site of inflammation. In addition to its chemotactic activity, Recombinant Mouse CCL11/Eotaxin Protein also induces the activation and degranulation of eosinophils, resulting in the release of inflammatory mediators such as cytokines, chemokines, and enzymes.

The activity of Recombinant Mouse CCL11/Eotaxin Protein is tightly regulated by various mechanisms. It can be inhibited by other chemokines, such as CCL5/RANTES and CXCL10/IP-10, which compete for binding to CCR3. Moreover, the activity of this protein can be modulated by glycosaminoglycans, which can either enhance or inhibit its binding to CCR3.

Applications of Recombinant Mouse CCL11/Eotaxin Protein

Recombinant Mouse CCL11/Eotaxin Protein has a wide range of applications in both research and clinical settings. In basic research, it is used to study the role of eosinophils in various diseases, including asthma, allergic rhinitis, and parasitic infections. It is also used to investigate the mechanisms of chemokine signaling and the regulation of immune cell migration.

In clinical applications, Recombinant Mouse CCL11/Eotaxin Protein has been evaluated as a potential therapeutic target for eosinophilic disorders. For instance, blocking the activity of this protein with specific antibodies has shown promising results in the treatment of eosinophilic esophagitis, a chronic inflammatory disease of the esophagus. Moreover, the measurement of CCL11 levels in patient samples has been proposed as a biomarker for the diagnosis and monitoring of eosinophilic diseases.

Conclusion

In summary, Recombinant Mouse CCL11/Eotaxin Protein is a small cytokine with a crucial role in the recruitment and activation of eosinophils. Its structure and activity have been extensively studied, and it has a wide range of applications in both research and clinical settings. Further research on this protein may lead to the development of novel therapies for

Recombinant Mouse CCL11/Eotaxin Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse CCL11/Eotaxin Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products