Name: Glucagon-like peptide 1 receptor(GLP1R) protein
SKU: PX-P4732-10
Availability: InStock

Product name	Glucagon-like peptide 1 receptor(GLP1R) protein
Uniprot ID	P43220
Uniprot link	https://www.uniprot.org/uniprot/P43220
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Molecular weight	14.31 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>95%by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL, 5% trehalose
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Arg24-Tyr145
Protein Accession	P43220
Spec:Entrez GeneID	2740
Spec:NCBI Gene Aliases	GLP-1; GLP-1R; GLP-1-R
Spec:SwissProtID	Q2M229
NCBI Reference	P43220
Aliases /Synonyms	GLP-1 receptor，GLP-1-R，GLP-1R
Reference	PX-P4732
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Glucagon-like peptide 1 receptor(GLP1R) protein”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product