Name: Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein
SKU: PX-P3017-10
Availability: InStock

Product name	Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein
Uniprot ID	B2CKR4
Uniprot link	http://www.uniprot.org/uniprot/B2CKR4
Origin species	Chinese sturgeon
Expression system	Eukaryotic expression
Sequence	MPASMPLLLLLFSALILSHSSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNYDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight	40.94 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Full-length
NCBI Reference	B2CKR4
Aliases /Synonyms	ICSH, Lutropin, Interstitial Cell Stimulating Hormone
Reference	PX-P3017
Note	For research use only

No Products found