Name: Anoctamin-6(Ano6) Fc Tag
SKU: PX-P4664-10
Availability: InStock

Product name	Anoctamin-6(Ano6) Fc Tag
Uniprot ID	Q6P9J9
Uniprot link	https://www.uniprot.org/uniprot/Q6P9J9
Origin species	House Mouse
Expression system	Eukaryotic expression
Sequence	MGWSCIILFLVATATGVHSAFTSDMIPRLVYYWSFSIPPYGDHTYYTMDGYINNTLSVFNITDFKNTDKENPYIGLGNYTLCRYRDFRNPPGHPQEYKHNDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight	9.91kDa
Protein delivered with Tag?	C-terminal Fc Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Ala745-Asn825
Protein Accession	Q6P9J9
Spec:Entrez GeneID	105722
Spec:NCBI Gene Aliases	Tmem16f; AA407480; AW554778; 2900059G15Rik; F730003B03Rik
Spec:SwissProtID	Q8C242
NCBI Reference	Q6P9J9
Aliases /Synonyms	Small-conductance calcium-activated nonselective cation channel,SCAN channel,Transmembrane protein 16F,Tmem16f
Reference	PX-P4664
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Anoctamin-6(Ano6) Fc Tag”

size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17868 180€

View product