Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Muromonab-Cd3 Biosimilar – Anti-CD3E mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG2a, kappa

Original price was: €470.00.Current price is: €370.00.

100ug 21% OFF + 370 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade

Product name Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 140608-64-6
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Muromonab-Cd3,OKT3,CD3E,anti-CD3E
Reference PX-TA1092
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-kappa
Clonality Monoclonal Antibody
Product name Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 140608-64-6
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Muromonab-Cd3,OKT3,CD3E,anti-CD3E
Reference PX-TA1092
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-kappa
Clonality Monoclonal Antibody
Product name PX-TA1092-50
Uniprot ID P07766
Source CAS 140608-64-6
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Muromonab-Cd3,OKT3,CD3E,anti-CD3E
Reference PX-TA1092
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody

The Structure of Muromonab-Cd3 Biosimilar

Muromonab-Cd3 Biosimilar, also known as Anti-CD3E monoclonal antibody, is a biosimilar version of the therapeutic antibody Muromonab-CD3. It is a recombinant, humanized IgG1 monoclonal antibody that specifically targets the CD3E subunit of the T-cell receptor complex. This biosimilar is produced using recombinant DNA technology in mammalian cell lines, making it a highly specific and potent therapeutic agent.

The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region is responsible for binding to the CD3E subunit, while the constant region mediates effector functions such as complement activation and antibody-dependent cellular cytotoxicity.

Activity of Muromonab-Cd3 Biosimilar

Muromonab-Cd3 Biosimilar is a potent immunosuppressant that works by binding to the CD3E subunit on T-cells, leading to their activation and proliferation. This results in the depletion of T-cells, which play a crucial role in immune responses. By targeting CD3E, Muromonab-Cd3 Biosimilar effectively suppresses the immune system, making it a valuable therapeutic agent for various immune-related disorders.

One of the main activities of Muromonab-Cd3 Biosimilar is its ability to treat acute rejection in organ transplant patients. When a transplanted organ is perceived as a foreign body, the body’s immune system mounts an attack, leading to organ rejection. By suppressing the immune system, Muromonab-Cd3 Biosimilar prevents this rejection and allows the transplanted organ to function properly.

In addition to its use in organ transplantation, Muromonab-Cd3 Biosimilar is also used in the treatment of autoimmune diseases such as rheumatoid arthritis, psoriasis, and multiple sclerosis. These conditions are characterized by an overactive immune system, and Muromonab-Cd3 Biosimilar helps to suppress this response and alleviate symptoms.

Application of Muromonab-Cd3 Biosimilar

Muromonab-Cd3 Biosimilar is primarily used in the treatment of acute rejection in organ transplant patients. It is typically administered intravenously in combination with other immunosuppressant drugs. The dosage and frequency of administration may vary depending on the patient’s condition and response to treatment.

This biosimilar is also being investigated for its potential use in the treatment of other immune-related disorders such as graft-versus-host disease and type 1 diabetes. It has shown promising results in clinical trials and may provide an alternative treatment option for these conditions in the future.

In addition to its therapeutic applications, Muromonab-Cd3 Biosimilar also has research-grade uses. It is commonly used in laboratory studies to understand the role of CD3E in T-cell activation and to develop new therapies for immune-related disorders. Its high specificity and potency make it a valuable tool for researchers in the field of immunology.

Conclusion

In summary, Muromonab-Cd3 Biosimilar is a recombinant, humanized IgG1 monoclonal antibody that specifically targets the CD3E subunit of the T-cell receptor complex. It is a potent immunosuppressant used in the treatment of acute rejection in organ transplant patients and various autoimmune diseases. This biosimilar also has research-grade applications and is a valuable tool for studying the immune system. With its high specificity and potency, Muromonab-Cd3 Biosimilar continues to be an important therapeutic agent in the field of immunology.

SDS-PAGE for Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade

SDS-PAGE for Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade

Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade

There are no reviews yet.

Be the first to review “Muromonab-Cd3 Biosimilar – Anti-CD3E mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Target Species
All
Applications
All
Clone Name
All
Name SKU View Clone
Anti-Human CD3 Antibody (TR66), PE ARO-A10567 View Clone
Anti-Human CD3 Antibody (SP34), FITC ARO-A10810 View Clone
Anti-Human CD3 Antibody (SP34), PE ARO-A10569 View Clone
Anti-Human CD3 Antibody (TR66), APC ARO-A10298 View Clone
Anti-Human CD3 Antibody (UCHT1) ARO-A15384 View Clone
Anti-Human CD3 Antibody (SP34), APC ARO-A10300 View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1092 View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1169 View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade PX-TA1617 View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1066 View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1245 View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1652 View Clone
Human CD3E (OKT3) Monoclonal Antibody ARO-A15835 View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody ARO-A15838 View Clone
Human CD3E (UCHT-1) Monoclonal Antibody ARO-A15841 View Clone
Human CD3E Monoclonal Antibody ARO-A15844 View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC ARO-A10814 View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC ARO-A10813 View Clone
Anti-Human CD3E Antibody (OKT3), FITC ARO-A10812 View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC ARO-A10811 View Clone
Anti-Human CD3 Antibody (UCHT1), FITC ARO-A10809 View Clone
Anti-Human CD3 Antibody (TR66), FITC ARO-A10504 View Clone
Anti-Human CD3E Antibody (TRX4), FITC ARO-A10808 View Clone
Anti-Human CD3 Antibody (HIT3a), FITC ARO-A10807 View Clone
Anti-Human CD3E Antibody (YTH12.5), APC ARO-A10304 View Clone
Anti-Human CD3E Antibody (UCHT-1), APC ARO-A10303 View Clone
Anti-Human CD3E Antibody (OKT3), APC ARO-A10302 View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC ARO-A10301 View Clone
Anti-Human CD3 Antibody (UCHT1), APC ARO-A10299 View Clone
Anti-Human CD3E Antibody (TRX4), APC ARO-A10297 View Clone
Anti-Human CD3 Antibody (HIT3a), APC ARO-A10296 View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP ARO-A10053 View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP ARO-A10052 View Clone
Anti-Human CD3E Antibody (OKT3), PerCP ARO-A10051 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP ARO-A10050 View Clone
Anti-Human CD3 Antibody (SP34), PerCP ARO-A10049 View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP ARO-A10048 View Clone
Anti-Human CD3 Antibody (TR66), PerCP ARO-A10047 View Clone
Anti-Human CD3E Antibody (TRX4), PerCP ARO-A10046 View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP ARO-A10045 View Clone
Anti-Human CD3E Antibody (YTH12.5), PE ARO-A10573 View Clone
Anti-Human CD3E Antibody (UCHT-1), PE ARO-A10572 View Clone
Anti-Human CD3E Antibody (OKT3), PE ARO-A10571 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE ARO-A10570 View Clone
Anti-Human CD3 Antibody (UCHT1), PE ARO-A10568 View Clone
Anti-Human CD3E Antibody (TRX4), PE ARO-A10566 View Clone
Anti-Human CD3 Antibody (HIT3a), PE ARO-A10565 View Clone
Anti-Human CD3E VHH (SAA1330) PTX18928-100 View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#) ARO-A13054 View Clone

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products