Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Visilizumab Biosimilar – Anti-CD3E mAb – Research Grade

  • PX-TA1066-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2-nd

Original price was: €181.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade

Product name Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 219716-33-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Visilizumab,HuM291,CD3E,anti-CD3E
Reference PX-TA1066
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody
Product name Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 219716-33-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Visilizumab,HuM291,CD3E,anti-CD3E
Reference PX-TA1066
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody
Product name PX-TA1066-50
Uniprot ID P07766
Source CAS 219716-33-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Visilizumab,HuM291,CD3E,anti-CD3E
Reference PX-TA1066
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody

Introduction

Visilizumab Biosimilar, also known as Anti-CD3E monoclonal antibody (mAb), is a research grade antibody that has gained significant attention in the field of immunology. It is a biosimilar version of the therapeutic antibody, Visilizumab, which is used in the treatment of autoimmune diseases and transplant rejection. In this article, we will discuss the structure, activity, and potential applications of Visilizumab Biosimilar in scientific research.

Structure of Visilizumab Biosimilar

Visilizumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody that specifically targets the CD3E subunit of the T-cell receptor complex. It is composed of two heavy chains and two light chains, each containing a constant and a variable region. The variable region of Visilizumab Biosimilar is derived from a mouse anti-human CD3E antibody, while the constant region is humanized to reduce potential immunogenicity.

Mechanism of Action

Visilizumab Biosimilar binds to the CD3E subunit on the surface of T-cells, leading to the activation of these cells. This activation triggers a cascade of events, including the release of cytokines and the proliferation of T-cells. This mechanism is similar to that of the original Visilizumab, which is used in the treatment of autoimmune diseases and transplant rejection.

Activity of Visilizumab Biosimilar

Visilizumab Biosimilar has been shown to have potent immunomodulatory effects. It can activate T-cells and enhance their cytotoxicity, making it a potential therapeutic agent for the treatment of cancer. Additionally, Visilizumab Biosimilar has been found to have a regulatory effect on the immune system, making it a promising candidate for the treatment of autoimmune diseases.

Applications in Scientific Research

Visilizumab Biosimilar has been extensively studied in preclinical and clinical trials for its potential applications in scientific research. Some of the key areas where it has shown promising results include:

Cancer Immunotherapy The ability of Visilizumab Biosimilar to activate T-cells and enhance their cytotoxicity makes it a potential candidate for cancer immunotherapy. It has been studied in various types of cancer, including melanoma, colorectal cancer, and non-small cell lung cancer, and has shown promising results in preclinical studies.

Autoimmune Diseases

Visilizumab Biosimilar has shown potential in the treatment of autoimmune diseases such as type 1 diabetes, rheumatoid arthritis, and multiple sclerosis. Its immunomodulatory effects can help regulate the overactive immune response seen in these diseases.

Transplant Rejection

As a biosimilar of the original Visilizumab, Visilizumab Biosimilar has the potential to be used in transplant rejection. It can prevent the activation of T-cells that can lead to the rejection of transplanted organs.

Research Tools

Visilizumab Biosimilar can also be used as a research tool in various immunological studies. Its ability to specifically target the CD3E subunit of the T-cell receptor complex makes it a valuable tool for studying T-cell activation and proliferation.

Conclusion

In conclusion, Visilizumab Biosimilar is a promising research grade antibody with potential applications in cancer immunotherapy, autoimmune diseases, transplant rejection, and as a research tool. Its specific targeting of the CD3E subunit and potent immunomodulatory effects make it a valuable addition to the field of immunology research. Further studies and clinical trials are needed to fully explore the potential of Visilizumab Biosimilar in these areas.

SDS-PAGE for Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade

SDS-PAGE for Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade

Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade binds to Recombinant Human CD3E Protein, N-His in ELISA Assay

Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade binds to Recombinant Human CD3E Protein, N-His in ELISA Assay

Recombinant Human CD3E Protein, N-His(cat. No.ARO-P10225) at 0.5µg/mL (100µL/well) can bind Visilizumab Biosimilar - Anti-CD3e mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade

There are no reviews yet.

Be the first to review “Visilizumab Biosimilar – Anti-CD3E mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Target Species
All
Applications
All
Clone Name
All
Name SKU View Clone
Anti-Human CD3 Antibody (TR66), PE ARO-A10567 View Clone
Anti-Human CD3 Antibody (SP34), FITC ARO-A10810 View Clone
Anti-Human CD3 Antibody (SP34), PE ARO-A10569 View Clone
Anti-Human CD3 Antibody (TR66), APC ARO-A10298 View Clone
Anti-Human CD3 Antibody (UCHT1) ARO-A15384 View Clone
Anti-Human CD3 Antibody (SP34), APC ARO-A10300 View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1092 View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1169 View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade PX-TA1617 View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1066 View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1245 View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1652 View Clone
Human CD3E (OKT3) Monoclonal Antibody ARO-A15835 View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody ARO-A15838 View Clone
Human CD3E (UCHT-1) Monoclonal Antibody ARO-A15841 View Clone
Human CD3E Monoclonal Antibody ARO-A15844 View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC ARO-A10814 View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC ARO-A10813 View Clone
Anti-Human CD3E Antibody (OKT3), FITC ARO-A10812 View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC ARO-A10811 View Clone
Anti-Human CD3 Antibody (UCHT1), FITC ARO-A10809 View Clone
Anti-Human CD3 Antibody (TR66), FITC ARO-A10504 View Clone
Anti-Human CD3E Antibody (TRX4), FITC ARO-A10808 View Clone
Anti-Human CD3 Antibody (HIT3a), FITC ARO-A10807 View Clone
Anti-Human CD3E Antibody (YTH12.5), APC ARO-A10304 View Clone
Anti-Human CD3E Antibody (UCHT-1), APC ARO-A10303 View Clone
Anti-Human CD3E Antibody (OKT3), APC ARO-A10302 View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC ARO-A10301 View Clone
Anti-Human CD3 Antibody (UCHT1), APC ARO-A10299 View Clone
Anti-Human CD3E Antibody (TRX4), APC ARO-A10297 View Clone
Anti-Human CD3 Antibody (HIT3a), APC ARO-A10296 View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP ARO-A10053 View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP ARO-A10052 View Clone
Anti-Human CD3E Antibody (OKT3), PerCP ARO-A10051 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP ARO-A10050 View Clone
Anti-Human CD3 Antibody (SP34), PerCP ARO-A10049 View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP ARO-A10048 View Clone
Anti-Human CD3 Antibody (TR66), PerCP ARO-A10047 View Clone
Anti-Human CD3E Antibody (TRX4), PerCP ARO-A10046 View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP ARO-A10045 View Clone
Anti-Human CD3E Antibody (YTH12.5), PE ARO-A10573 View Clone
Anti-Human CD3E Antibody (UCHT-1), PE ARO-A10572 View Clone
Anti-Human CD3E Antibody (OKT3), PE ARO-A10571 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE ARO-A10570 View Clone
Anti-Human CD3 Antibody (UCHT1), PE ARO-A10568 View Clone
Anti-Human CD3E Antibody (TRX4), PE ARO-A10566 View Clone
Anti-Human CD3 Antibody (HIT3a), PE ARO-A10565 View Clone
Anti-Human CD3E VHH (SAA1330) PTX18928-100 View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#) ARO-A13054 View Clone

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products