Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Otelixizumab Biosimilar – Anti-CD3E mAb – Research Grade

  • PX-TA1169-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €272.00.Current price is: €200.00.

100ug 26% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade

Product name Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 881191-44-2
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Otelixizumab,ChAglyCD,TRX4,CD3E,anti-CD3E
Reference PX-TA1169
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade
Uniprot ID P07766
Source CAS 881191-44-2
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Otelixizumab,ChAglyCD,TRX4,CD3E,anti-CD3E
Reference PX-TA1169
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1169-50
Uniprot ID P07766
Source CAS 881191-44-2
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Otelixizumab,ChAglyCD,TRX4,CD3E,anti-CD3E
Reference PX-TA1169
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Otelixizumab Biosimilar – Anti-CD3E mAb – Research Grade

Otelixizumab Biosimilar – Anti-CD3E mAb – Research Grade: A Promising Antibody for Therapeutic Targeting Otelixizumab Biosimilar is a monoclonal antibody (mAb) that specifically targets CD3E, a protein found on the surface of T cells. This biosimilar is a highly effective and safe alternative to the original Otelixizumab, which has been used for the treatment of autoimmune diseases and organ transplant rejection. In this article, we will explore the structure, activity, and potential applications of Otelixizumab Biosimilar in the field of immunotherapy.

Structure of Otelixizumab Biosimilar

Otelixizumab Biosimilar is a recombinant humanized IgG1-kappa monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, and is produced in Chinese hamster ovary (CHO) cells. The antibody has a specific binding site for CD3E, which is located on the constant region of the heavy chain. This binding site is essential for the antibody’s therapeutic activity.

Activity of Otelixizumab Biosimilar

Otelixizumab Biosimilar works by binding to CD3E on the surface of T cells, which are a type of immune cell responsible for fighting infections and diseases. This binding triggers a cascade of events that leads to the activation and proliferation of T cells. This, in turn, enhances the body’s immune response against foreign invaders, such as viruses, bacteria, and cancer cells. Additionally, Otelixizumab Biosimilar can also modulate the production of cytokines, which are small proteins involved in immune signaling. This activity of Otelixizumab Biosimilar makes it a potent immunomodulatory agent with potential therapeutic benefits.

Potential Applications of Otelixizumab Biosimilar

Otelixizumab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various autoimmune diseases, such as type 1 diabetes, rheumatoid arthritis, and multiple sclerosis. It has also been investigated for its potential in preventing organ transplant rejection. The immunomodulatory activity of Otelixizumab Biosimilar makes it a suitable candidate for combination therapy with other immunosuppressive drugs, thereby reducing the risk of adverse effects and improving treatment outcomes.

Autoimmune Diseases

Autoimmune diseases occur when the immune system mistakenly attacks healthy cells and tissues in the body. Otelixizumab Biosimilar has shown promising results in clinical trials for the treatment of type 1 diabetes, a chronic autoimmune disease in which the immune system attacks and destroys insulin-producing cells in the pancreas. The antibody has also been investigated for its potential in treating rheumatoid arthritis, a chronic inflammatory disease that affects the joints, and multiple sclerosis, a neurodegenerative autoimmune disorder.

Organ Transplant Rejection

Organ transplantation is a life-saving procedure for patients with end-stage organ failure. However, the immune system often recognizes the transplanted organ as foreign and attacks it, leading to organ rejection. Otelixizumab Biosimilar has been studied for its ability to prevent organ rejection by modulating the immune response. In a clinical trial, Otelixizumab Biosimilar showed promising results in reducing the incidence of acute rejection in kidney transplant patients.

Combination Therapy

Otelixizumab Biosimilar has also been investigated for its potential in combination therapy with other immunosuppressive drugs, such as corticosteroids and calcine

SDS-PAGE for Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade

SDS-PAGE for Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade

Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade binds to Recombinant Human CD3E Protein, N-His in ELISA Assay

Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade binds to Recombinant Human CD3E Protein, N-His in ELISA Assay

Recombinant Human CD3E Protein, N-His(cat. No.ARO-P10225) at 0.5µg/mL (100µL/well) can bind Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade

There are no reviews yet.

Be the first to review “Otelixizumab Biosimilar – Anti-CD3E mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Target Species
All
Applications
All
Clone Name
All
Name SKU View Clone
Anti-Human CD3 Antibody (TR66), PE ARO-A10567 View Clone
Anti-Human CD3 Antibody (SP34), FITC ARO-A10810 View Clone
Anti-Human CD3 Antibody (SP34), PE ARO-A10569 View Clone
Anti-Human CD3 Antibody (TR66), APC ARO-A10298 View Clone
Anti-Human CD3 Antibody (UCHT1) ARO-A15384 View Clone
Anti-Human CD3 Antibody (SP34), APC ARO-A10300 View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1092 View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1169 View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade PX-TA1617 View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1066 View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1245 View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1652 View Clone
Human CD3E (OKT3) Monoclonal Antibody ARO-A15835 View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody ARO-A15838 View Clone
Human CD3E (UCHT-1) Monoclonal Antibody ARO-A15841 View Clone
Human CD3E Monoclonal Antibody ARO-A15844 View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC ARO-A10814 View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC ARO-A10813 View Clone
Anti-Human CD3E Antibody (OKT3), FITC ARO-A10812 View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC ARO-A10811 View Clone
Anti-Human CD3 Antibody (UCHT1), FITC ARO-A10809 View Clone
Anti-Human CD3 Antibody (TR66), FITC ARO-A10504 View Clone
Anti-Human CD3E Antibody (TRX4), FITC ARO-A10808 View Clone
Anti-Human CD3 Antibody (HIT3a), FITC ARO-A10807 View Clone
Anti-Human CD3E Antibody (YTH12.5), APC ARO-A10304 View Clone
Anti-Human CD3E Antibody (UCHT-1), APC ARO-A10303 View Clone
Anti-Human CD3E Antibody (OKT3), APC ARO-A10302 View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC ARO-A10301 View Clone
Anti-Human CD3 Antibody (UCHT1), APC ARO-A10299 View Clone
Anti-Human CD3E Antibody (TRX4), APC ARO-A10297 View Clone
Anti-Human CD3 Antibody (HIT3a), APC ARO-A10296 View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP ARO-A10053 View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP ARO-A10052 View Clone
Anti-Human CD3E Antibody (OKT3), PerCP ARO-A10051 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP ARO-A10050 View Clone
Anti-Human CD3 Antibody (SP34), PerCP ARO-A10049 View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP ARO-A10048 View Clone
Anti-Human CD3 Antibody (TR66), PerCP ARO-A10047 View Clone
Anti-Human CD3E Antibody (TRX4), PerCP ARO-A10046 View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP ARO-A10045 View Clone
Anti-Human CD3E Antibody (YTH12.5), PE ARO-A10573 View Clone
Anti-Human CD3E Antibody (UCHT-1), PE ARO-A10572 View Clone
Anti-Human CD3E Antibody (OKT3), PE ARO-A10571 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE ARO-A10570 View Clone
Anti-Human CD3 Antibody (UCHT1), PE ARO-A10568 View Clone
Anti-Human CD3E Antibody (TRX4), PE ARO-A10566 View Clone
Anti-Human CD3 Antibody (HIT3a), PE ARO-A10565 View Clone
Anti-Human CD3E VHH (SAA1330) PTX18928-100 View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#) ARO-A13054 View Clone

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products