Brand: ProteoGenix

CD3E Recombinant Protein

PX-P4075-100
Validated ELISA

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: P07766
Molecular weight:: 18kDa

Original price was: €500.00.Current price is: €420.00.

100ug 16% OFF + 420 loyalty points

Met1~Asp126 His

Size Size

50ug Original price was: €368.00.Current price is: €294.00.
100ug Original price was: €500.00.Current price is: €420.00.
1MG Original price was: €1,376.00.Current price is: €1,218.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Mosunetuzumab Biosimilar - Anti-CD3E, MS4A1, CD20 mAb binds to CD3E Recombinant Protein in indirect ELISA Assay

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Datasheet

CD3E Recombinant Protein

Product name	PX-P4075-100
Uniprot ID	P07766
Uniprot link	http://www.uniprot.org/uniprot/P07766
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Molecular weight	18kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1~Asp126
Aliases /Synonyms	T3E
Reference	PX-P4075
Note	For research use only.
Molecular Constructor	Met1~Asp126 His

Product name	PX-P4075-1MG
Uniprot ID	P07766
Uniprot link	http://www.uniprot.org/uniprot/P07766
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Molecular weight	18kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1~Asp126
Aliases /Synonyms	T3E
Reference	PX-P4075
Note	For research use only.
Molecular Constructor	Met1~Asp126 His

Product name	PX-P4075-50
Uniprot ID	P07766
Uniprot link	http://www.uniprot.org/uniprot/P07766
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Molecular weight	18kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1~Asp126
Aliases /Synonyms	T3E
Reference	PX-P4075
Note	For research use only.
Molecular Constructor	Met1~Asp126 His

Datasheet

Mosunetuzumab Biosimilar - Anti-CD3E, MS4A1, CD20 mAb binds to CD3E Recombinant Protein in indirect ELISA Assay

Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind to Mosunetuzumab Biosimilar - Anti-CD3E, MS4A1, CD20 mAb (cat. No.PX-TA1482) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade (cat. No.PX-TA1824) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 5.855M.

Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade (cat. No.PX-TA1564) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 2.045M.