Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD3E Recombinant Protein |
|---|---|
| Uniprot ID | P07766 |
| Uniprot link | http://www.uniprot.org/uniprot/P07766 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD |
| Molecular weight | 18kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Asp126 |
| Aliases /Synonyms | T3E |
| Reference | PX-P4075 |
| Note | For research use only. |
Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind to Mosunetuzumab Biosimilar - Anti-CD3E, MS4A1, CD20 mAb (cat. No.PX-TA1482) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade (cat. No.PX-TA1824) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 5.855M.
Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade (cat. No.PX-TA1564) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 2.045M.
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.