Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human CD3 Antibody (UCHT1)

  • ARO-A15384-100
  • Validated FC

Original price was: €493.00.Current price is: €391.00.

100ug 21% OFF + 391 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Anti-Human CD3 Antibody (UCHT1)
Flow Cytometry results for Anti-Human CD3 Antibody (UCHT1)
Anti-Human CD3 Antibody (UCHT1)
49 clones available

Anti-Human CD3 Antibody (UCHT1)

Product name ARO-A15384-100
Uniprot ID P07766
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15384
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3E
Clone Name UCHT1
Protein Name CD3E
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15384-1MG
Uniprot ID P07766
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15384
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3E
Clone Name UCHT1
Protein Name CD3E
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15384-50
Uniprot ID P07766
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15384
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3E
Clone Name UCHT1
Protein Name CD3E
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Anti-Human CD3 Antibody (UCHT1)

Flow Cytometry results for Anti-Human CD3 Antibody (UCHT1)

Jurkat cells were stained with an irrelevant antibody (Blue Histogram) or Anti-Human CD3 Antibody (UCHT1) (ARO-A15384 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Anti-Human CD3 Antibody (UCHT1)

Flow Cytometry results for Anti-Human CD3 Antibody (UCHT1)

Target Cells were stained with an irrelevant antibody or Anti-Human CD3 Antibody (UCHT1) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Anti-Human CD3 Antibody (UCHT1)

There are no reviews yet.

Be the first to review “Anti-Human CD3 Antibody (UCHT1)”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Target Species
All
Applications
All
Clone Name
All
Name SKU View Clone
Anti-Human CD3 Antibody (TR66), PE ARO-A10567 View Clone
Anti-Human CD3 Antibody (SP34), FITC ARO-A10810 View Clone
Anti-Human CD3 Antibody (SP34), PE ARO-A10569 View Clone
Anti-Human CD3 Antibody (TR66), APC ARO-A10298 View Clone
Anti-Human CD3 Antibody (UCHT1) ARO-A15384 View Clone
Anti-Human CD3 Antibody (SP34), APC ARO-A10300 View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1092 View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1169 View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade PX-TA1617 View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1066 View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1245 View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1652 View Clone
Human CD3E (OKT3) Monoclonal Antibody ARO-A15835 View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody ARO-A15838 View Clone
Human CD3E (UCHT-1) Monoclonal Antibody ARO-A15841 View Clone
Human CD3E Monoclonal Antibody ARO-A15844 View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC ARO-A10814 View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC ARO-A10813 View Clone
Anti-Human CD3E Antibody (OKT3), FITC ARO-A10812 View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC ARO-A10811 View Clone
Anti-Human CD3 Antibody (UCHT1), FITC ARO-A10809 View Clone
Anti-Human CD3 Antibody (TR66), FITC ARO-A10504 View Clone
Anti-Human CD3E Antibody (TRX4), FITC ARO-A10808 View Clone
Anti-Human CD3 Antibody (HIT3a), FITC ARO-A10807 View Clone
Anti-Human CD3E Antibody (YTH12.5), APC ARO-A10304 View Clone
Anti-Human CD3E Antibody (UCHT-1), APC ARO-A10303 View Clone
Anti-Human CD3E Antibody (OKT3), APC ARO-A10302 View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC ARO-A10301 View Clone
Anti-Human CD3 Antibody (UCHT1), APC ARO-A10299 View Clone
Anti-Human CD3E Antibody (TRX4), APC ARO-A10297 View Clone
Anti-Human CD3 Antibody (HIT3a), APC ARO-A10296 View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP ARO-A10053 View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP ARO-A10052 View Clone
Anti-Human CD3E Antibody (OKT3), PerCP ARO-A10051 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP ARO-A10050 View Clone
Anti-Human CD3 Antibody (SP34), PerCP ARO-A10049 View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP ARO-A10048 View Clone
Anti-Human CD3 Antibody (TR66), PerCP ARO-A10047 View Clone
Anti-Human CD3E Antibody (TRX4), PerCP ARO-A10046 View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP ARO-A10045 View Clone
Anti-Human CD3E Antibody (YTH12.5), PE ARO-A10573 View Clone
Anti-Human CD3E Antibody (UCHT-1), PE ARO-A10572 View Clone
Anti-Human CD3E Antibody (OKT3), PE ARO-A10571 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE ARO-A10570 View Clone
Anti-Human CD3 Antibody (UCHT1), PE ARO-A10568 View Clone
Anti-Human CD3E Antibody (TRX4), PE ARO-A10566 View Clone
Anti-Human CD3 Antibody (HIT3a), PE ARO-A10565 View Clone
Anti-Human CD3E VHH (SAA1330) PTX18928-100 View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#) ARO-A13054 View Clone

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products