Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P07766
Molecular weight:
15.09kDa

210.00

50ug + 210 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein

Product name Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein
Uniprot ID P07766
Uniprot link http://www.uniprot.org/uniprot/P07766
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDGSHHHHHH
Molecular weight 15.09kDa
Protein delivered with Tag? Yes
Purity estimated 60%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD3E, T3E, TCRE, CD3-E Molecule,Epsilon(CD3-TCR Complex), T-cell surface antigen T3/Leu-4 epsilon chain
Reference PX-P4014
Note For research use only
Molecular Constructor
Partial Yes
Product name Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein
Uniprot ID P07766
Uniprot link http://www.uniprot.org/uniprot/P07766
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDGSHHHHHH
Molecular weight 15.09kDa
Protein delivered with Tag? Yes
Purity estimated 60%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD3E, T3E, TCRE, CD3-E Molecule,Epsilon(CD3-TCR Complex), T-cell surface antigen T3/Leu-4 epsilon chain
Reference PX-P4014
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products