Brand: ProteoGenix

Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein

PX-P4014-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: P07766
Molecular weight:: 15.09kDa

€210.00

50ug + 210 loyalty points

Partial Yes

size size

50ug €210.00
100ug €420.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein

Product name	Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein
Uniprot ID	P07766
Uniprot link	http://www.uniprot.org/uniprot/P07766
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDGSHHHHHH
Molecular weight	15.09kDa
Protein delivered with Tag?	Yes
Purity estimated	60%
Buffer	50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	CD3E, T3E, TCRE, CD3-E Molecule,Epsilon(CD3-TCR Complex), T-cell surface antigen T3/Leu-4 epsilon chain
Reference	PX-P4014
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human T-cell surface glycoprotein CD3 epsilon chain (CD3E) recombinant protein
Uniprot ID	P07766
Uniprot link	http://www.uniprot.org/uniprot/P07766
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDGSHHHHHH
Molecular weight	15.09kDa
Protein delivered with Tag?	Yes
Purity estimated	60%
Buffer	50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	CD3E, T3E, TCRE, CD3-E Molecule,Epsilon(CD3-TCR Complex), T-cell surface antigen T3/Leu-4 epsilon chain
Reference	PX-P4014
Note	For research use only
Molecular Constructor	Partial Yes