Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Teplizumab Biosimilar – Anti-CD3 mAb – Research Grade

  • PX-TA1617-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody

Original price was: €276.00.Current price is: €200.00.

100ug 28% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade

Product name Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade
Uniprot ID P07766
Source CAS 876387-05-2
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Teplizumab,MGA-031/MGA031;PRV-031,CD3,anti-CD3
Reference PX-TA1617
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody
Product name Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade
Uniprot ID P07766
Source CAS 876387-05-2
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Teplizumab,MGA-031/MGA031;PRV-031,CD3,anti-CD3
Reference PX-TA1617
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody
Product name PX-TA1617-50
Uniprot ID P07766
Source CAS 876387-05-2
Expression system Mammalian cells
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Teplizumab,MGA-031/MGA031;PRV-031,CD3,anti-CD3
Reference PX-TA1617
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody

Introduction to Teplizumab Biosimilar – Anti-CD3 mAb – Research Grade

Teplizumab Biosimilar, also known as Anti-CD3 monoclonal antibody (mAb), is a promising therapeutic agent that has shown potential in the treatment of various autoimmune diseases. This biosimilar is a replica of the original Teplizumab, which is a humanized anti-CD3 mAb. The research grade of this biosimilar is specifically designed for use in laboratory research and pre-clinical studies. In this article, we will delve into the structure, activity, and applications of Teplizumab Biosimilar in detail.

Structure of Teplizumab Biosimilar

Teplizumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody that is composed of two heavy and two light chains. The heavy chains are made up of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL) and one variable domain (VL). The variable domains of both heavy and light chains are responsible for binding to the CD3 antigen, which is present on the surface of T cells.

The biosimilar is produced using recombinant DNA technology, where the gene for the variable region of the antibody is fused with the constant region of a human IgG1 antibody. This humanization process reduces the risk of immune reactions and increases the half-life of the antibody in the body.

Activity of Teplizumab Biosimilar

The main function of Teplizumab Biosimilar is to bind to the CD3 antigen on T cells and modulate their activity. CD3 is a complex protein that is involved in the activation and proliferation of T cells. By binding to CD3, Teplizumab Biosimilar inhibits the activation and proliferation of T cells, leading to a decrease in the production of inflammatory cytokines and a reduction in the activity of autoimmune diseases.

Teplizumab Biosimilar has also been shown to induce regulatory T cells (Tregs), which play a crucial role in maintaining immune tolerance and preventing autoimmune diseases. Tregs are responsible for suppressing the activity of other immune cells, including T cells, B cells, and dendritic cells. By increasing the number of Tregs, Teplizumab Biosimilar helps to restore immune balance and control autoimmune reactions.

Therapeutic Applications of Teplizumab Biosimilar

Teplizumab Biosimilar has shown promising results in the treatment of various autoimmune diseases, including type 1 diabetes, rheumatoid arthritis, and multiple sclerosis. In type 1 diabetes, the biosimilar has been shown to delay the progression of the disease and preserve beta-cell function, leading to improved glycemic control. In rheumatoid arthritis, Teplizumab Biosimilar has been found to reduce disease activity and improve symptoms. In multiple sclerosis, the biosimilar has shown potential in reducing the number and severity of relapses.

Moreover, Teplizumab Biosimilar has also been studied for its potential in preventing organ rejection in transplant patients. By modulating T cell activity, the biosimilar can help reduce the risk of graft rejection and improve transplant outcomes.

Conclusion

Teplizumab Biosimilar – Anti-CD3 mAb – Research Grade is a promising therapeutic agent with a unique mechanism of action. Its ability to bind to the CD3 antigen and modulate T cell activity makes it a potential treatment option for various autoimmune diseases. With further research and clinical trials, Teplizumab Biosimilar has the potential to improve the lives of patients suffering from these debilitating conditions.

Keywords: Teplizumab Biosimilar, Anti-CD3 mAb, research grade, antibody, therapeutic target

SDS-PAGE for Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade

SDS-PAGE for Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade in ELISA Assay

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade in ELISA Assay

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Teplizumab Biosimilar – Anti-CD3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Target Species
All
Applications
All
Clone Name
All
Name SKU View Clone
Anti-Human CD3 Antibody (TR66), PE ARO-A10567 View Clone
Anti-Human CD3 Antibody (SP34), FITC ARO-A10810 View Clone
Anti-Human CD3 Antibody (SP34), PE ARO-A10569 View Clone
Anti-Human CD3 Antibody (TR66), APC ARO-A10298 View Clone
Anti-Human CD3 Antibody (UCHT1) ARO-A15384 View Clone
Anti-Human CD3 Antibody (SP34), APC ARO-A10300 View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1092 View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1169 View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade PX-TA1617 View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1066 View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1245 View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1652 View Clone
Human CD3E (OKT3) Monoclonal Antibody ARO-A15835 View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody ARO-A15838 View Clone
Human CD3E (UCHT-1) Monoclonal Antibody ARO-A15841 View Clone
Human CD3E Monoclonal Antibody ARO-A15844 View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC ARO-A10814 View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC ARO-A10813 View Clone
Anti-Human CD3E Antibody (OKT3), FITC ARO-A10812 View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC ARO-A10811 View Clone
Anti-Human CD3 Antibody (UCHT1), FITC ARO-A10809 View Clone
Anti-Human CD3 Antibody (TR66), FITC ARO-A10504 View Clone
Anti-Human CD3E Antibody (TRX4), FITC ARO-A10808 View Clone
Anti-Human CD3 Antibody (HIT3a), FITC ARO-A10807 View Clone
Anti-Human CD3E Antibody (YTH12.5), APC ARO-A10304 View Clone
Anti-Human CD3E Antibody (UCHT-1), APC ARO-A10303 View Clone
Anti-Human CD3E Antibody (OKT3), APC ARO-A10302 View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC ARO-A10301 View Clone
Anti-Human CD3 Antibody (UCHT1), APC ARO-A10299 View Clone
Anti-Human CD3E Antibody (TRX4), APC ARO-A10297 View Clone
Anti-Human CD3 Antibody (HIT3a), APC ARO-A10296 View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP ARO-A10053 View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP ARO-A10052 View Clone
Anti-Human CD3E Antibody (OKT3), PerCP ARO-A10051 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP ARO-A10050 View Clone
Anti-Human CD3 Antibody (SP34), PerCP ARO-A10049 View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP ARO-A10048 View Clone
Anti-Human CD3 Antibody (TR66), PerCP ARO-A10047 View Clone
Anti-Human CD3E Antibody (TRX4), PerCP ARO-A10046 View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP ARO-A10045 View Clone
Anti-Human CD3E Antibody (YTH12.5), PE ARO-A10573 View Clone
Anti-Human CD3E Antibody (UCHT-1), PE ARO-A10572 View Clone
Anti-Human CD3E Antibody (OKT3), PE ARO-A10571 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE ARO-A10570 View Clone
Anti-Human CD3 Antibody (UCHT1), PE ARO-A10568 View Clone
Anti-Human CD3E Antibody (TRX4), PE ARO-A10566 View Clone
Anti-Human CD3 Antibody (HIT3a), PE ARO-A10565 View Clone
Anti-Human CD3E VHH (SAA1330) PTX18928-100 View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#) ARO-A13054 View Clone

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products