Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD3 Antibody (SP34)

Original price was: €438.00.Current price is: €342.00.

100ug 22% OFF + 342 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD3 Antibody (SP34)

Product name ARO-A15465-100
Uniprot ID P07766
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15465
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3
Clone Name SP34
Protein Name CD3
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15465-1MG
Uniprot ID P07766
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15465
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3
Clone Name SP34
Protein Name CD3
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15465-50
Uniprot ID P07766
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15465
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3
Clone Name SP34
Protein Name CD3
Target species Anti-Human Monoclonal Antibody

Introduction

Anti-Human CD3 Antibody (SP34) is a monoclonal antibody that specifically targets the CD3 protein found on the surface of T cells. This antibody has been extensively studied and has shown promising results as a therapeutic target for various diseases. In this article, we will discuss the structure, activity, and potential applications of Anti-Human CD3 Antibody (SP34).

Structure of Anti-Human CD3 Antibody (SP34)

Anti-Human CD3 Antibody (SP34) is a monoclonal antibody, meaning it is produced by a single clone of cells and has a highly specific binding affinity for its target. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The variable regions of these chains determine the specificity of the antibody for its target, in this case, the CD3 protein.

Activity of Anti-Human CD3 Antibody (SP34)

The main function of Anti-Human CD3 Antibody (SP34) is to bind to the CD3 protein on the surface of T cells. This binding triggers a signaling cascade that activates the T cells, leading to their proliferation and production of cytokines. This activation of T cells is crucial for their role in the immune response against pathogens and cancer cells.

In addition to activating T cells, Anti-Human CD3 Antibody (SP34) can also induce apoptosis (programmed cell death) in certain types of T cells. This makes it a potential treatment for diseases characterized by an overactive immune response, such as autoimmune disorders.

Therapeutic Applications of Anti-Human CD3 Antibody (SP34)

One of the most promising therapeutic applications of Anti-Human CD3 Antibody (SP34) is in the treatment of autoimmune diseases. By selectively targeting and depleting specific subsets of T cells, this antibody can suppress the overactive immune response that causes these diseases. In fact, Anti-Human CD3 Antibody (SP34) has already been approved for the treatment of graft-versus-host disease (GVHD), a serious complication of bone marrow transplantation.

Another potential application of Anti-Human CD3 Antibody (SP34) is in the treatment of certain types of cancer. By activating T cells and enhancing their anti-tumor activity, this antibody can potentially be used as an immunotherapy to target and kill cancer cells. Clinical trials are currently underway to evaluate the efficacy of Anti-Human CD3 Antibody (SP34) in various types of cancer, including leukemia, lymphoma, and solid tumors.

Research Use of Anti-Human CD3 Antibody (SP34)

Apart from its therapeutic applications, Anti-Human CD3 Antibody (SP34) is also widely used in research. This antibody is commonly used to study the function of T cells and their role in various diseases. It is also used in in vitro experiments to activate T cells and study their response to different stimuli.

Furthermore, Anti-Human CD3 Antibody (SP34) is used in flow cytometry to identify and quantify T cells in a sample. This technique is crucial in monitoring the immune response and assessing the effectiveness of immunotherapies.

Conclusion

In summary, Anti-Human CD3 Antibody (SP34) is a monoclonal antibody that specifically targets the CD3 protein on the surface of T cells. Its main activity is to activate T cells and induce their proliferation and cytokine production. This antibody has shown promising results as a therapeutic target for autoimmune diseases and cancer, and is also widely used in research to study the function of T cells. With ongoing research and clinical trials, Anti-Human CD3 Antibody (SP34) has the potential to revolutionize the treatment of various diseases and improve patient outcomes.

SDS-PAGE for Anti-Human CD3 Antibody (SP34)

SDS-PAGE for Anti-Human CD3 Antibody (SP34)

Anti-Human CD3 Antibody (SP34), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CD3 Antibody (SP34)

There are no reviews yet.

Be the first to review “Anti-Human CD3 Antibody (SP34)”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Target Species
All
Applications
All
Clone Name
All
Name SKU View Clone
Anti-Human CD3 Antibody (TR66), PE ARO-A10567 View Clone
Anti-Human CD3 Antibody (SP34), FITC ARO-A10810 View Clone
Anti-Human CD3 Antibody (SP34), PE ARO-A10569 View Clone
Anti-Human CD3 Antibody (TR66), APC ARO-A10298 View Clone
Anti-Human CD3 Antibody (UCHT1) ARO-A15384 View Clone
Anti-Human CD3 Antibody (SP34), APC ARO-A10300 View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1092 View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1169 View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade PX-TA1617 View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1066 View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1245 View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1652 View Clone
Human CD3E (OKT3) Monoclonal Antibody ARO-A15835 View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody ARO-A15838 View Clone
Human CD3E (UCHT-1) Monoclonal Antibody ARO-A15841 View Clone
Human CD3E Monoclonal Antibody ARO-A15844 View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC ARO-A10814 View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC ARO-A10813 View Clone
Anti-Human CD3E Antibody (OKT3), FITC ARO-A10812 View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC ARO-A10811 View Clone
Anti-Human CD3 Antibody (UCHT1), FITC ARO-A10809 View Clone
Anti-Human CD3 Antibody (TR66), FITC ARO-A10504 View Clone
Anti-Human CD3E Antibody (TRX4), FITC ARO-A10808 View Clone
Anti-Human CD3 Antibody (HIT3a), FITC ARO-A10807 View Clone
Anti-Human CD3E Antibody (YTH12.5), APC ARO-A10304 View Clone
Anti-Human CD3E Antibody (UCHT-1), APC ARO-A10303 View Clone
Anti-Human CD3E Antibody (OKT3), APC ARO-A10302 View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC ARO-A10301 View Clone
Anti-Human CD3 Antibody (UCHT1), APC ARO-A10299 View Clone
Anti-Human CD3E Antibody (TRX4), APC ARO-A10297 View Clone
Anti-Human CD3 Antibody (HIT3a), APC ARO-A10296 View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP ARO-A10053 View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP ARO-A10052 View Clone
Anti-Human CD3E Antibody (OKT3), PerCP ARO-A10051 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP ARO-A10050 View Clone
Anti-Human CD3 Antibody (SP34), PerCP ARO-A10049 View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP ARO-A10048 View Clone
Anti-Human CD3 Antibody (TR66), PerCP ARO-A10047 View Clone
Anti-Human CD3E Antibody (TRX4), PerCP ARO-A10046 View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP ARO-A10045 View Clone
Anti-Human CD3E Antibody (YTH12.5), PE ARO-A10573 View Clone
Anti-Human CD3E Antibody (UCHT-1), PE ARO-A10572 View Clone
Anti-Human CD3E Antibody (OKT3), PE ARO-A10571 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE ARO-A10570 View Clone
Anti-Human CD3 Antibody (UCHT1), PE ARO-A10568 View Clone
Anti-Human CD3E Antibody (TRX4), PE ARO-A10566 View Clone
Anti-Human CD3 Antibody (HIT3a), PE ARO-A10565 View Clone
Anti-Human CD3E VHH (SAA1330) PTX18928-100 View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#) ARO-A13054 View Clone

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products