Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human BST2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q10589
Molecular weight:
39.49 kDa

Original price was: €378.00.Current price is: €329.00.

100ug 13% OFF + 329 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human BST2 Recombinant Protein

Product name Human BST2 Recombinant Protein
Uniprot ID Q10589
Uniprot link http://www.uniprot.org/uniprot/Q10589
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Molecular weight 39.49 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:Entrez GeneID BST2
NCBI Reference Q10589
Aliases /Synonyms HM1.24 antigen, Tetherin, CD317
Reference PX-P3037
Note For research use only
Molecular Constructor
Partial Yes
Product name Human BST2 Recombinant Protein
Uniprot ID Q10589
Uniprot link http://www.uniprot.org/uniprot/Q10589
Origin species Homo sapiens (Human)
Expression system Procaryotic expression
Raw Antigen Sequence SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Molecular weight 39.49 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:Entrez GeneID BST2
NCBI Reference Q10589
Aliases /Synonyms HM1.24 antigen, Tetherin, CD317
Reference PX-P3037
Note For research use only
Molecular Constructor
Partial Yes
Product name Human BST2 Recombinant Protein
Uniprot ID Q10589
Uniprot link http://www.uniprot.org/uniprot/Q10589
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Molecular weight 39.49 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:Entrez GeneID BST2
NCBI Reference Q10589
Aliases /Synonyms HM1.24 antigen, Tetherin, CD317
Reference PX-P3037
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P3037-1MG
Uniprot ID Q10589
Uniprot link http://www.uniprot.org/uniprot/Q10589
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Molecular weight 39.49 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:Entrez GeneID BST2
NCBI Reference Q10589
Aliases /Synonyms HM1.24 antigen, Tetherin, CD317
Reference PX-P3037
Note For research use only
Molecular Constructor
Partial Yes

Human BST2 Recombinant Protein

There are no reviews yet.

Be the first to review “Human BST2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products