Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cadherin-1(CDH1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P12830
Molecular weight:
23.11 kDa

Original price was: €218.00.Current price is: €182.00.

50ug 17% OFF + 182 loyalty points
His Asp155–Asp367
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Cadherin-1(CDH1)

Product name Cadherin-1(CDH1)
Uniprot ID P12830
Uniprot link https://www.uniprot.org/uniprot/P12830
Expression system Prokaryotic expression
Raw Antigen Sequence DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTD
Molecular weight 23.11 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp155-Asp367
Protein Accession P12830
Spec:Entrez GeneID 999
Spec:NCBI Gene Aliases UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324
Spec:SwissProtID Q13799
NCBI Reference P12830
Aliases /Synonyms CAM 120/80,Epithelial cadherin,E-cadherin,Uvomorulin,CD_antigen: CD324,CDHE, UVO
Reference PX-P4709
Note For research use only
Molecular Constructor
His Asp155–Asp367
Product name Cadherin-1(CDH1)
Uniprot ID P12830
Uniprot link https://www.uniprot.org/uniprot/P12830
Expression system Prokaryotic expression
Raw Antigen Sequence DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTD
Molecular weight 23.11 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp155-Asp367
Protein Accession P12830
Spec:Entrez GeneID 999
Spec:NCBI Gene Aliases UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324
Spec:SwissProtID Q13799
NCBI Reference P12830
Aliases /Synonyms CAM 120/80,Epithelial cadherin,E-cadherin,Uvomorulin,CD_antigen: CD324,CDHE, UVO
Reference PX-P4709
Note For research use only
Molecular Constructor
His Asp155–Asp367
Product name PX-P4709-1MG
Uniprot ID P12830
Uniprot link https://www.uniprot.org/uniprot/P12830
Expression system Prokaryotic expression
Raw Antigen Sequence DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTD
Molecular weight 23.11 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp155-Asp367
Protein Accession P12830
Spec:Entrez GeneID 999
Spec:NCBI Gene Aliases UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324
Spec:SwissProtID Q13799
NCBI Reference P12830
Aliases /Synonyms CAM 120/80,Epithelial cadherin,E-cadherin,Uvomorulin,CD_antigen: CD324,CDHE, UVO
Reference PX-P4709
Note For research use only
Molecular Constructor
His Asp155–Asp367

Cadherin-1(CDH1)

There are no reviews yet.

Be the first to review “Cadherin-1(CDH1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products