Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

C-type lectin domain family 9 member A(CLEC9A)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q6UXN8
Molecular weight:
24.35kDa

€182.00

+ 182 loyalty points
Lys57–Val241
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
C-type lectin domain family 9 member A(CLEC9A)

C-type lectin domain family 9 member A(CLEC9A)

Product name C-type lectin domain family 9 member A(CLEC9A)
Uniprot ID Q6UXN8
Uniprot link https://www.uniprot.org/uniprot/Q6UXN8
Expression system Prokaryotic expression
Sequence MKYLLPTAAAGLLLLAAQPAMAKLLQVSTIAMQQQEKLIQQERALLNFTEWKRSCALQMKYCQAFMQNSLSSAHNSSPCP NNWIQNRESCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWVGLSQDGHSGRWLWQDGSSP SPGLLPAERSQSANQVCGYVKSNSLLSSNCSTWKYFICEKYALRSSVGSHHHHHH
Molecular weight 24.35kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys57-Val241
Aliases /Synonyms CD370
Reference PX-P4353
Note For research use only
Molecular Constructor
Lys57–Val241
Product name C-type lectin domain family 9 member A(CLEC9A)
Uniprot ID Q6UXN8
Uniprot link https://www.uniprot.org/uniprot/Q6UXN8
Expression system Prokaryotic expression
Sequence MKYLLPTAAAGLLLLAAQPAMAKLLQVSTIAMQQQEKLIQQERALLNFTEWKRSCALQMKYCQAFMQNSLSSAHNSSPCP NNWIQNRESCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWVGLSQDGHSGRWLWQDGSSP SPGLLPAERSQSANQVCGYVKSNSLLSSNCSTWKYFICEKYALRSSVGSHHHHHH
Molecular weight 24.35kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5, 4M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys57-Val241
Aliases /Synonyms CD370
Reference PX-P4353
Note For research use only
Molecular Constructor
Lys57–Val241

There are no reviews yet.

Be the first to review “C-type lectin domain family 9 member A(CLEC9A)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products