Streptococcus pyogenes Endo-beta-N-acetylglucosaminidase F2 recombinant protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameStreptococcus pyogenes Endo-beta-N-acetylglucosaminidase F2 recombinant protein
Uniprot IDQ9APG4
Uniprot linkhttp://www.uniprot.org/uniprot/Q9APG4
Origin speciesStreptococcus pyogenes
Expression systemProcaryotic expression
SequenceMGSHHHHHHSGEEKTVQVQKGLPSIDSLHYLSENSKKEFKEELSKAGQESQKVKEILAKAQQADKQAQELAKMKIPEKIP MKPLHGPLYGGYFRTWHDKTSDPTEKDKVNSMGELPKEVDLAFIFHDWTKDYSLFWKELATKHVPKLNKQGTRVIRTIPW RFLAGGDNSGIAEDTSKYPNTPEGNKALAKAIVDEYVYKYNLDGLDVDVEHDSIPKVDKKEDTAGVERSIQVFEEIGKLI GPKGVDKSRLFIMDSTYMADKNPLIERGAPYINLLLVQVYGSQGEKGGWEPVSNRPEKTMEERWQGYSKYIRPEQYMIGF SFYEENAQEGNLWYDINSRKDEDKANGINTDITGTRAERYARWQPKTGGVKGGIFSYAIDRDGVAHQPKKYAKQKEFKDA TDNIFHSDYSVSKALKTVMLKDKSYDLIDEKDFPDKALREAVMAQVGTRKGDLERFNGTLRLDNPAIQSLEGLNKFKKLA QLDLIGLSRITKLDRSVLPANMKPGKDTLETVLETYKKDNKEEPATIPPVSLKVSGLTGLKELDLSGFDRETLAGLDAAT LTSLEKVDISGNKLDLAPGTENRQIFDTMLSTISNHVGSNEQTVKFDKQKPTGHYPDTYGKTSLRLPVANEKVDLQSQLL FGTVTNQGTLINSEADYKAYQNHKIAGRSFVDSNYHYNNFKVSYENYTVKVTDSTLGTTTDKTLATDKEETYKVDFFSPA DKTKAVHTAKVIVGDEKTMMVNLAEGATVIGGSADPVNARKVFDGQLGSETDNISLGWDSKQSIIFKLKEDGLIKHWRFF NDSARNPETTNKPIQEASLQIFNIKDYNLDNLLENPNKFDDEKYWITVDTYSAQGERATAFSNTLNNITSKYWRVVFDTK GDRYSSPVVPELQILGYPLPNADTIMKTVTTAKELSQQKDKFSQKMLDELKIKEMALETSLNSKIFDVTAINANAGVLKD CIEKRQLLKK
Molecular weight109.1kDa
Protein delivered with Tag?Yes
Purity estimated85%
BufferPBS, pH 7.5
FormLyophilized
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Aliases /SynonymsEndoS, ndoS, Endo-beta-N-acetylglucosaminidase F2, Secreted endoglycosidase EndoS, Endo-beta-N-acetylglucosaminidase F2
ReferencePX-P4005
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Streptococcus pyogenes Endo-beta-N-acetylglucosaminidase F2 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

4F2Mab Biosimilar – Anti-ganglioside GD2,  SFRP1, SLC3A2 mAb – Research Grade
Biosimilar 4F2Mab Biosimilar – Anti-ganglioside GD2, SFRP1, SLC3A2 mAb – Research Grade PX-TA1073 400€
Afelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade
Biosimilar Afelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade PX-TA1088 400€
Otilimab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade
Biosimilar Otilimab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade PX-TA1141 400€
CDP571 Biosimilar – Anti-TNFSF2, TNF alpha, TNFA mAb – Research Grade
Biosimilar CDP571 Biosimilar – Anti-TNFSF2, TNF alpha, TNFA mAb – Research Grade PX-TA1154 400€
Rovelizumab Biosimilar – Anti-ITGAL, CD11a, ITGB2, CD18 mAb – Research Grade
Biosimilar Rovelizumab Biosimilar – Anti-ITGAL, CD11a, ITGB2, CD18 mAb – Research Grade PX-TA1216 400€
Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade
Biosimilar Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade PX-TA1219 400€
Mavrilimumab Biosimilar – Anti-CSF2RA, CD116  mAb – Research Grade
Biosimilar Mavrilimumab Biosimilar – Anti-CSF2RA, CD116 mAb – Research Grade PX-TA1241 400€
Namilumab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade
Biosimilar Namilumab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade PX-TA1259 400€
Ozoralizumab Biosimilar – Anti-ALB, TNFSF2, TNF-alpha, TNFA  mAb – Research Grade
Biosimilar Ozoralizumab Biosimilar – Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb – Research Grade PX-TA1272 400€
Placulumab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade
Biosimilar Placulumab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade PX-TA1302 400€
Dusigitumab Biosimilar – Anti-IGF1, IGF2 mAb – Research Grade
Biosimilar Dusigitumab Biosimilar – Anti-IGF1, IGF2 mAb – Research Grade PX-TA1310 400€
Lenzilumab Biosimilar – Anti-CSF2 mAb – Research Grade
Biosimilar Lenzilumab Biosimilar – Anti-CSF2 mAb – Research Grade PX-TA1360 400€
Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade
Biosimilar Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade PX-TA1362 400€
Xentuzumab Biosimilar – Anti-IGF1, IGF2  mAb – Research Grade
Biosimilar Xentuzumab Biosimilar – Anti-IGF1, IGF2 mAb – Research Grade PX-TA1409 400€
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)
Receptor Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA) PX-P4584 108€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.