Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade

  • PX-TA1219-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: €183.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Nerelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Product name Nerelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Source CAS 162774-06-3
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Nerelimomab,BAYX1351,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1219
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Nerelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Source CAS 162774-06-3
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Nerelimomab,BAYX1351,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1219
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1219-50
Uniprot ID P01375
Source CAS 162774-06-3
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Nerelimomab,BAYX1351,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1219
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction

Nerelimomab Biosimilar, also known as Anti-TNFSF2 or TNF-alpha monoclonal antibody (mAb), is a research grade therapeutic agent that targets the cytokine TNF-alpha. This protein is a key mediator of inflammation and is involved in a variety of diseases such as rheumatoid arthritis, Crohn’s disease, and psoriasis. Nerelimomab Biosimilar is a promising treatment option for these conditions and has the potential to improve patient outcomes.

Structure of Nerelimomab Biosimilar

Nerelimomab Biosimilar is a monoclonal antibody, meaning it is a laboratory-produced protein that mimics the body’s natural antibodies. The antibody is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the target protein, while the constant region is involved in immune system activation.

Activity of Nerelimomab Biosimilar

Nerelimomab Biosimilar binds specifically to TNF-alpha, preventing it from binding to its receptors and exerting its pro-inflammatory effects. This leads to a decrease in inflammation and symptoms associated with diseases where TNF-alpha is overproduced. Additionally, Nerelimomab Biosimilar can also promote the clearance of TNF-alpha by activating the immune system to recognize and remove the bound protein.

Application of Nerelimomab Biosimilar

Nerelimomab Biosimilar has shown promising results in preclinical studies for the treatment of various inflammatory diseases. In a mouse model of rheumatoid arthritis, Nerelimomab Biosimilar significantly reduced joint inflammation and destruction. It has also been shown to be effective in treating inflammatory bowel disease, with a reduction in symptoms and improvement in intestinal tissue damage.

In addition to its potential as a therapeutic agent, Nerelimomab Biosimilar has also been used in research to study the role of TNF-alpha in various diseases. By blocking TNF-alpha activity, researchers can better understand the mechanisms of inflammation and potentially identify new therapeutic targets.

Future Directions

Nerelimomab Biosimilar is currently in the research and development stage, with clinical trials underway to evaluate its safety and efficacy in human patients. If successful, it has the potential to become a valuable treatment option for inflammatory diseases with limited treatment options. Furthermore, ongoing research on the role of TNF-alpha in other diseases may lead to the discovery of new applications for Nerelimomab Biosimilar.

Conclusion

Nerelimomab Biosimilar is a promising research grade therapeutic agent that targets the pro-inflammatory cytokine TNF-alpha. Its specific binding to TNF-alpha and ability to promote its clearance make it a potential treatment option for various inflammatory diseases. Ongoing research and clinical trials will provide more insight into the efficacy and safety of this antibody, paving the way for its potential use in the clinic.

Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in ELISA Assay

Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in ELISA Assay

Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Flow Cytometry results for Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade

Flow Cytometry results for Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Nerelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products