Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CDP571 Biosimilar – Anti-TNFSF2, TNF alpha, TNFA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €278.00.Current price is: €200.00.

100ug 28% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CDP571 Biosimilar - Anti-TNFSF2, TNF alpha, TNFA mAb - Research Grade

Product name CDP571 Biosimilar - Anti-TNFSF2, TNF alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms CDP571,B3 (dsFv) -PE38,LMB-9 BAY 103356,BAY W 3356,CDP571,TNFSF2, TNF alpha, TNFA,anti-TNFSF2, TNF alpha, TNFA
Reference PX-TA1154
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name CDP571 Biosimilar - Anti-TNFSF2, TNF alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms CDP571,B3 (dsFv) -PE38,LMB-9 BAY 103356,BAY W 3356,CDP571,TNFSF2, TNF alpha, TNFA,anti-TNFSF2, TNF alpha, TNFA
Reference PX-TA1154
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1154-50
Uniprot ID P01375
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms CDP571,B3 (dsFv) -PE38,LMB-9 BAY 103356,BAY W 3356,CDP571,TNFSF2, TNF alpha, TNFA,anti-TNFSF2, TNF alpha, TNFA
Reference PX-TA1154
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

CDP571 Biosimilar is a monoclonal antibody that specifically targets TNFSF2, also known as tumor necrosis factor alpha (TNF alpha). This biosimilar is a research grade antibody that has been developed as a potential therapeutic agent for various inflammatory and autoimmune diseases.

Structure of CDP571 Biosimilar

CDP571 Biosimilar is a recombinant monoclonal antibody that is produced in a laboratory using recombinant DNA technology. It is a fully humanized antibody, meaning that it is derived from human cells and has a high degree of similarity to natural human antibodies.

The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains are made up of four constant regions and one variable region, while the light chains have two constant regions and one variable region. These variable regions are responsible for binding to the target TNFSF2 molecule.

Activity of CDP571 Biosimilar

CDP571 Biosimilar works by binding to TNFSF2, a cytokine that plays a crucial role in the regulation of inflammatory responses. TNFSF2 is produced by various cells in the body, including immune cells, and is involved in the activation of inflammatory pathways.

By binding to TNFSF2, CDP571 Biosimilar inhibits its activity and prevents it from binding to its receptors on target cells. This, in turn, reduces the production of pro-inflammatory cytokines and helps to control the inflammatory response.

Application of CDP571 Biosimilar

CDP571 Biosimilar has shown potential as a therapeutic agent for various inflammatory and autoimmune diseases, including rheumatoid arthritis, psoriasis, Crohn’s disease, and ulcerative colitis. These diseases are characterized by an overproduction of TNFSF2 and other pro-inflammatory cytokines.

In preclinical studies, CDP571 Biosimilar has demonstrated the ability to reduce inflammation and improve disease symptoms in animal models of these conditions. It has also been shown to be well-tolerated and safe in human clinical trials.

Currently, CDP571 Biosimilar is being evaluated in phase III clinical trials for the treatment of rheumatoid arthritis and psoriasis. These trials aim to further assess the safety and efficacy of the biosimilar in a larger population of patients.

Conclusion

In summary, CDP571 Biosimilar is a recombinant monoclonal antibody that specifically targets TNFSF2, a key cytokine involved in inflammatory responses. It has shown potential as a therapeutic agent for various inflammatory and autoimmune diseases and is currently being evaluated in phase III clinical trials.

As a research grade antibody, CDP571 Biosimilar can also be used in laboratory studies to further understand the role of TNFSF2 in disease and to develop new treatments for these conditions. With its high specificity and potential therapeutic benefits, CDP571 Biosimilar holds promise as a valuable tool in the fight against inflammatory and autoimmune diseases.

SDS-PAGE for CDP571 Biosimilar - Anti-TNFSF2; TNF alpha; TNFA mAb - Research Grade

SDS-PAGE for CDP571 Biosimilar - Anti-TNFSF2; TNF alpha; TNFA mAb - Research Grade

CDP571 Biosimilar - Anti-TNFSF2; TNF alpha; TNFA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

CDP571 Biosimilar - Anti-TNFSF2, TNF alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “CDP571 Biosimilar – Anti-TNFSF2, TNF alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products