Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Otilimab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade

  • PX-TA1141-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €182.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Otilimab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade

Product name Otilimab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1638332-55-4
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Otilimab,MOR-04357,3196165,GSK3196165,MOR103,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1141
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Otilimab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1638332-55-4
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Otilimab,MOR-04357,3196165,GSK3196165,MOR103,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1141
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1141-50
Uniprot ID P04141
Source CAS 1638332-55-4
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Otilimab,MOR-04357,3196165,GSK3196165,MOR103,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1141
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Otilimab Biosimilar, also known as Anti-CSF2, GM-CSF mAb, is a research grade monoclonal antibody that has shown promising results in the treatment of various inflammatory and autoimmune diseases. In this article, we will delve into the structure, activity, and potential applications of this novel therapeutic agent.

Structure of Otilimab Biosimilar

Otilimab Biosimilar is a recombinant, humanized monoclonal antibody that specifically targets the cytokine granulocyte-macrophage colony-stimulating factor (GM-CSF). It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The antibody is produced using Chinese hamster ovary (CHO) cells and is glycosylated, meaning it has sugar molecules attached to it. This glycosylation is important for the stability and activity of the antibody.

Activity of Otilimab Biosimilar

As mentioned earlier, Otilimab Biosimilar targets GM-CSF, a cytokine that plays a crucial role in the development and activation of immune cells. By binding to GM-CSF, Otilimab Biosimilar blocks its activity, leading to a reduction in the production and activation of inflammatory cells such as neutrophils, macrophages, and dendritic cells. This results in a decrease in the levels of pro-inflammatory cytokines and chemokines, ultimately leading to a decrease in inflammation.

Applications of Otilimab Biosimilar

Otilimab Biosimilar has shown promising results in various pre-clinical and clinical studies as a potential treatment for inflammatory and autoimmune diseases. Some of the conditions it has been studied for include rheumatoid arthritis, psoriasis, multiple sclerosis, and asthma.

Rheumatoid Arthritis

Rheumatoid arthritis (RA) is a chronic autoimmune disease characterized by inflammation and destruction of joints. Otilimab Biosimilar has been shown to significantly reduce disease activity in patients with moderate to severe RA, as well as improve physical function and reduce joint damage. It has also been well-tolerated in clinical trials, with a favorable safety profile.

Psoriasis

Psoriasis is a chronic skin disease caused by an overactive immune system. In a phase II clinical trial, Otilimab Biosimilar was found to be effective in reducing the severity of psoriasis, with a significant improvement in skin lesions and symptoms. It was also well-tolerated, with no serious adverse events reported.

Multiple Sclerosis

Multiple sclerosis (MS) is an autoimmune disease that affects the central nervous system. Otilimab Biosimilar has shown promising results in reducing the number of relapses and slowing disease progression in patients with relapsing-remitting MS. It has also been shown to improve brain lesions and physical functioning in these patients.

Asthma

Asthma is a chronic respiratory disease characterized by airway inflammation and narrowing. Otilimab Biosimilar has been studied as a potential treatment for severe asthma, with promising results. It has been shown to reduce asthma exacerbations and improve lung function in patients with uncontrolled asthma.

Conclusion

In conclusion, Otilimab Biosimilar, also known as Anti-CSF2, GM-CSF mAb, is a research grade monoclonal antibody with a unique structure and mechanism of action. It has shown promising results in various inflammatory and autoimmune diseases, making it a potential therapeutic option for these conditions. Further research and clinical trials are needed to fully understand the efficacy and safety of this novel antibody, but it holds great potential in improving the lives of patients with these debilitating diseases.

Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade binds to CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein in ELISA assay

Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade binds to CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein in ELISA assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade (cat. No.PX-TA1141) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 152.1M.

Flow Cytometry results for Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade

Flow Cytometry results for Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Otilimab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade

There are no reviews yet.

Be the first to review “Otilimab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products