Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Xentuzumab Biosimilar – Anti-IGF1, IGF2 mAb – Research Grade

  • PX-TA1409-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €183.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade

Product name Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade
Uniprot ID P05019 & P01344
Source CAS 1417158-65-6
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Xentuzumab,BI 836845,IGF1, IGF2 ,anti-IGF1, IGF2
Reference PX-TA1409
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade
Uniprot ID P05019 & P01344
Source CAS 1417158-65-6
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Xentuzumab,BI 836845,IGF1, IGF2 ,anti-IGF1, IGF2
Reference PX-TA1409
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1409-50
Uniprot ID P05019 & P01344
Source CAS 1417158-65-6
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Xentuzumab,BI 836845,IGF1, IGF2 ,anti-IGF1, IGF2
Reference PX-TA1409
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

General information on Anti-IGF1/IGF2 [Homo sapiens] (Xentuzumab) Monoclonal Antibody

Xentuzumab is investigated for the treatment of Epidermal Growth Factor Receptor (EGFR) Mutant Non-small Cell Lung Cancer (NSCLC).

SDS-PAGE for Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb

SDS-PAGE for Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb

Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Xentuzumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade in ELISA Assay

Xentuzumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade in ELISA Assay

Xentuzumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Xentuzumab Biosimilar - Anti-IGF1, IGF2  mAb - Research Grade

There are no reviews yet.

Be the first to review “Xentuzumab Biosimilar – Anti-IGF1, IGF2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products