Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade

  • PX-TA1362-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
[VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer

Original price was: €252.00.Current price is: €200.00.

100ug 21% OFF + 200 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade in ELISA Assay
Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Product name Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID Q16552 & P01375
Source CAS 1791410-27-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Remtolumab,A-1230717,ABT-122,IL17A, TNFSF2, TNF-alpha, TNFA,anti-IL17A, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1362
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer
Clonality Monoclonal Antibody
Product name Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID Q16552 & P01375
Source CAS 1791410-27-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Remtolumab,A-1230717,ABT-122,IL17A, TNFSF2, TNF-alpha, TNFA,anti-IL17A, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1362
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer
Clonality Monoclonal Antibody
Product name PX-TA1362-50
Uniprot ID Q16552 & P01375
Source CAS 1791410-27-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Remtolumab,A-1230717,ABT-122,IL17A, TNFSF2, TNF-alpha, TNFA,anti-IL17A, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1362
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer
Clonality Monoclonal Antibody

General information on Anti-IL17A/TNFSF2/TNF-alpha/TNFA[Homo sapiens] (Remtolumab) Monoclonal Antibody

Remtolumab is investigated for the treatment of Rheumatoid Arthritis.

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade in ELISA Assay

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade in ELISA Assay

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products