Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade

  • PX-TA1362-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
[VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Product name Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID Q16552 & P01375
Source CAS 1791410-27-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Remtolumab,A-1230717,ABT-122,IL17A, TNFSF2, TNF-alpha, TNFA,anti-IL17A, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1362
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer
Clonality Monoclonal Antibody
Product name Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID Q16552 & P01375
Source CAS 1791410-27-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Remtolumab,A-1230717,ABT-122,IL17A, TNFSF2, TNF-alpha, TNFA,anti-IL17A, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1362
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer
Clonality Monoclonal Antibody
Product name PX-TA1362-50
Uniprot ID Q16552 & P01375
Source CAS 1791410-27-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Remtolumab,A-1230717,ABT-122,IL17A, TNFSF2, TNF-alpha, TNFA,anti-IL17A, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1362
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer
Clonality Monoclonal Antibody

General information on Anti-IL17A/TNFSF2/TNF-alpha/TNFA[Homo sapiens] (Remtolumab) Monoclonal Antibody

Remtolumab is investigated for the treatment of Rheumatoid Arthritis.

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade in ELISA Assay

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade in ELISA Assay

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products