Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Dusigitumab Biosimilar – Anti-IGF1, IGF2 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG2-nd

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Dusigitumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade

Product name Dusigitumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade
Uniprot ID P05019 & P01344
Source CAS 1204390-13-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Dusigitumab,MEDI-573,IGF1, IGF2,anti-IGF1, IGF2
Reference PX-TA1310
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody
Product name Dusigitumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade
Uniprot ID P05019 & P01344
Source CAS 1204390-13-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Dusigitumab,MEDI-573,IGF1, IGF2,anti-IGF1, IGF2
Reference PX-TA1310
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody
Product name PX-TA1310-50
Uniprot ID P05019 & P01344
Source CAS 1204390-13-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Dusigitumab,MEDI-573,IGF1, IGF2,anti-IGF1, IGF2
Reference PX-TA1310
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-nd
Clonality Monoclonal Antibody

General information on Anti-IGF1/IGF2[Homo sapiens] (Dusigitumab) Monoclonal Antibody

Dusigitumab has been investigated for the treatment of Cancer, Advanced Solid Malignancies, Unresectable or Metastatic Hepatocellular Carcinoma (HCC), and Hormone-sensitive, HER-2 Negative Metastatic Breast Cancer.

SDS-PAGE for Dusigitumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade

SDS-PAGE for Dusigitumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade

Dusigitumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Dusigitumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Dusigitumab Biosimilar – Anti-IGF1, IGF2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products