Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Ozoralizumab Biosimilar – Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
VH-VH'-VH

Original price was: €272.00.Current price is: €200.00.

100ug 26% OFF + 200 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Ozoralizumab Biosimilar - Anti-TNFa and ALB mAb - Research Grade
Ozoralizumab Biosimilar - Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Ozoralizumab Biosimilar - Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Product name Ozoralizumab Biosimilar - Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375 & P02768
Source CAS 1167985-17-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ozoralizumab,ATN-103,ALB, TNFSF2, TNF-alpha, TNFA ,anti-ALB, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1272
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody
Product name Ozoralizumab Biosimilar - Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375 & P02768
Source CAS 1167985-17-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ozoralizumab,ATN-103,ALB, TNFSF2, TNF-alpha, TNFA ,anti-ALB, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1272
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody
Product name PX-TA1272-50
Uniprot ID P01375 & P02768
Source CAS 1167985-17-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ozoralizumab,ATN-103,ALB, TNFSF2, TNF-alpha, TNFA ,anti-ALB, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1272
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VH'-VH
Clonality Monoclonal Antibody

General information on Anti-ALB/TNFSF2/TNF-alpha/TNFA [Homo sapiens] (Ozoralizumab) Monoclonal Antibody

Ozoralizumab has been investigated for the treatment of Rheumatoid Arthritis.

SDS-PAGE for Ozoralizumab Biosimilar - Anti-TNFa and ALB mAb - Research Grade

SDS-PAGE for Ozoralizumab Biosimilar - Anti-TNFa and ALB mAb - Research Grade

Ozoralizumab Biosimilar - Anti-TNFa and ALB mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ozoralizumab Biosimilar - Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Ozoralizumab Biosimilar – Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products