Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P15509
Molecular weight:
60 kDa（36.91 kDa)

€210.00

50ug + 210 loyalty points
Met1–Gly320 His
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)

Product name Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)
Uniprot ID P15509
Uniprot link https://www.uniprot.org/uniprot/P15509
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
Molecular weight 60 kDa（36.91 kDa)
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly320
Protein Accession P15509
Spec:Entrez GeneID 1438
Spec:NCBI Gene Aliases GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GMR-alpha; GMCSFR-alpha; GM-CSF-R-alpha
Spec:SwissProtID Q16564
NCBI Reference P15509
Aliases /Synonyms CSF2R, CSF2RY,GM-CSF-R-alpha，GMCSFR-alpha，GMR-alpha，CDw116，CD116
Reference PX-P4584
Note For research use only
Molecular Constructor
Met1–Gly320 His
Product name Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)
Uniprot ID P15509
Uniprot link https://www.uniprot.org/uniprot/P15509
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
Molecular weight 60 kDa（36.91 kDa)
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly320
Protein Accession P15509
Spec:Entrez GeneID 1438
Spec:NCBI Gene Aliases GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GMR-alpha; GMCSFR-alpha; GM-CSF-R-alpha
Spec:SwissProtID Q16564
NCBI Reference P15509
Aliases /Synonyms CSF2R, CSF2RY,GM-CSF-R-alpha，GMCSFR-alpha，GMR-alpha，CDw116，CD116
Reference PX-P4584
Note For research use only
Molecular Constructor
Met1–Gly320 His

There are no reviews yet.

Be the first to review “Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products