Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Namilumab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade

  • PX-TA1259-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €171.00.Current price is: €140.00.

50ug 18% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade

Product name Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1206681-39-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Namilumab,MT203,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1259
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1206681-39-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Namilumab,MT203,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1259
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1259-50
Uniprot ID P04141
Source CAS 1206681-39-1
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Namilumab,MT203,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1259
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-CSF2/GM-CSF[Homo sapiens] (Namilumab) Monoclonal Antibody

Namilumab has beeninvestigated for the treatment of Plaque Psoriasis and Rheumatoid Arthritis.

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb (cat. No.PX-TA1259) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 34.24M.

SDS-PAGE for Namilumab Biosimilar - Anti-CSF2; GM-CSF mAb - Research Grade

SDS-PAGE for Namilumab Biosimilar - Anti-CSF2; GM-CSF mAb - Research Grade

Namilumab Biosimilar - Anti-CSF2; GM-CSF mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade

There are no reviews yet.

Be the first to review “Namilumab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products