Brand: ProteoGenix

Lenzilumab Biosimilar – Anti-CSF2 mAb – Research Grade

PX-TA1360-50
Validated ELISA

Isotype:: IgG1, kappa

Original price was: €175.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points

Size Size

50ug Original price was: €175.00.Current price is: €140.00.
100ug Original price was: €266.00.Current price is: €200.00.
1MG Original price was: €518.00.Current price is: €405.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Lenzilumab Biosimilar - Anti-CSF2 mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

SDS-PAGE for Lenzilumab Biosimilar - Anti-CSF2 mAb

Lenzilumab Biosimilar - Anti-CSF2 mAb - Research Grade

Product name	Lenzilumab Biosimilar - Anti-CSF2 mAb - Research Grade
Uniprot ID	P04141
Source	CAS 1229575-09-0
Species	Homo sapiens
Expression system	Mammalian cells
Raw Antigen Sequence	MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Lenzilumab,KB-003,CSF2,anti-CSF2
Reference	PX-TA1360
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	Lenzilumab Biosimilar - Anti-CSF2 mAb - Research Grade
Uniprot ID	P04141
Source	CAS 1229575-09-0
Species	Homo sapiens
Expression system	Mammalian cells
Raw Antigen Sequence	MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Lenzilumab,KB-003,CSF2,anti-CSF2
Reference	PX-TA1360
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1-kappa
Clonality	Monoclonal Antibody

Product name	PX-TA1360-50
Uniprot ID	P04141
Source	CAS 1229575-09-0
Species	Homo sapiens
Expression system	Mammalian cells
Raw Antigen Sequence	MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Aliases /Synonyms	Lenzilumab,KB-003,CSF2,anti-CSF2
Reference	PX-TA1360
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa

General information on Anti-CSF2[Homo sapiens] (Lenzilumab) Monoclonal Antibody

Lenzilumab is investigated for the treatment of Chronic Myelomonocytic Leukemia (CMML).

Lenzilumab Biosimilar - Anti-CSF2 mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Lenzilumab Biosimilar - Anti-CSF2 mAb (cat. No.PX-TA1360) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 33.07M.

SDS-PAGE for Lenzilumab Biosimilar - Anti-CSF2 mAb

Lenzilumab Biosimilar - Anti-CSF2 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.