Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Drosophila SO Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Drosophila
Uniprot ID:
Q27350
Molecular weight:
34,98 kDa

Original price was: €311.00.Current price is: €259.00.

50ug 17% OFF + 259 loyalty points
Partial No
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Drosophila SO Recombinant Protein

Product name Drosophila SO Recombinant Protein
Uniprot ID Q27350
Uniprot link http://www.uniprot.org/uniprot/Q27350
Origin species Drosophila
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMLQHPATDF YDLAAANAAAVLTARHTPPYSPTGLSGSVALHNNNNNNSSTSNNNNSTLDIMAHNGGGAGGGLHLNSSSNGGGG
Molecular weight 34,98 kDa
Protein delivered with Tag? No
Purity estimated 60%
Buffer Tris-HCl 50mM, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_476733.1
Spec:Entrez GeneID 35662
Spec:NCBI Gene Aliases ami, med, old, mda, Mdu, So, Drl, SO, somda, DmelCG11121, CG11121
Spec:SwissProtID Q27350
NCBI Reference NP_476733.1
Aliases /Synonyms SO, sine oculis
Reference PX-P1154
Note For research use only
Molecular Constructor
Partial No
Product name Drosophila SO Recombinant Protein
Uniprot ID Q27350
Uniprot link http://www.uniprot.org/uniprot/Q27350
Origin species Drosophila
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMLQHPATDF YDLAAANAAAVLTARHTPPYSPTGLSGSVALHNNNNNNSSTSNNNNSTLDIMAHNGGGAGGGLHLNSSSNGGGG
Molecular weight 34,98 kDa
Protein delivered with Tag? No
Purity estimated 60%
Buffer Tris-HCl 50mM, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_476733.1
Spec:Entrez GeneID 35662
Spec:NCBI Gene Aliases ami, med, old, mda, Mdu, So, Drl, SO, somda, DmelCG11121, CG11121
Spec:SwissProtID Q27350
NCBI Reference NP_476733.1
Aliases /Synonyms SO, sine oculis
Reference PX-P1154
Note For research use only
Molecular Constructor
Partial No
Product name PX-P1154-1MG
Uniprot ID Q27350
Uniprot link http://www.uniprot.org/uniprot/Q27350
Origin species Drosophila
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMLQHPATDF YDLAAANAAAVLTARHTPPYSPTGLSGSVALHNNNNNNSSTSNNNNSTLDIMAHNGGGAGGGLHLNSSSNGGGG
Molecular weight 34,98 kDa
Protein delivered with Tag? No
Purity estimated 60%
Buffer Tris-HCl 50mM, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_476733.1
Spec:Entrez GeneID 35662
Spec:NCBI Gene Aliases ami, med, old, mda, Mdu, So, Drl, SO, somda, DmelCG11121, CG11121
Spec:SwissProtID Q27350
NCBI Reference NP_476733.1
Aliases /Synonyms SO, sine oculis
Reference PX-P1154
Note For research use only
Molecular Constructor
Partial No

Drosophila SO Recombinant Protein

There are no reviews yet.

Be the first to review “Drosophila SO Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products