Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sulesomab Biosimilar – Anti-NCA-90 mAb – Research Grade

  • PX-TA1099-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
Fab'-G1-nd

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Sulesomab Biosimilar - Anti-NCA-90 mAb - Research Grade

Product name Sulesomab Biosimilar - Anti-NCA-90 mAb - Research Grade
Uniprot ID P40199
Source CAS 167747-19-5
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Sulesomab,IMMU-MN3,Technetium (99mTc) sulesomab,LeukoScan,NCA-90,anti-NCA-90
Reference PX-TA1099
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody
Product name Sulesomab Biosimilar - Anti-NCA-90 mAb - Research Grade
Uniprot ID P40199
Source CAS 167747-19-5
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Sulesomab,IMMU-MN3,Technetium (99mTc) sulesomab,LeukoScan,NCA-90,anti-NCA-90
Reference PX-TA1099
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody
Product name PX-TA1099-50
Uniprot ID P40199
Source CAS 167747-19-5
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sulesomab,IMMU-MN3,Technetium (99mTc) sulesomab,LeukoScan,NCA-90,anti-NCA-90
Reference PX-TA1099
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody

Sulesomab Biosimilar: A Revolutionary Antibody for Targeting NCA-90

Sulesomab Biosimilar, also known as Anti-NCA-90 mAb, is a novel monoclonal antibody that has been developed as a biosimilar to the original sulesomab antibody. This biosimilar has been designed to target NCA-90, a cell surface protein that is overexpressed in various types of cancer, making it a promising therapeutic target for cancer treatment.

Structure of Sulesomab Biosimilar

Sulesomab Biosimilar is a recombinant monoclonal antibody that is produced using advanced biotechnology methods. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy chains are connected to each other by disulfide bonds, while the light chains are connected to the heavy chains by disulfide bonds and non-covalent interactions. The variable regions of the antibody, responsible for binding to NCA-90, are located at the tips of the heavy and light chains.

The structure of Sulesomab Biosimilar is highly specific and precise, allowing it to bind to NCA-90 with high affinity and specificity. This specificity is crucial for the effectiveness of the antibody as a therapeutic agent.

Activity of Sulesomab Biosimilar

The main activity of Sulesomab Biosimilar is its ability to bind to NCA-90 on the surface of cancer cells. NCA-90 is a glycoprotein that is overexpressed in various types of cancer, including breast, lung, and colon cancer. By binding to NCA-90, Sulesomab Biosimilar blocks its function and disrupts the signaling pathways that promote cancer growth and survival.

In addition, Sulesomab Biosimilar also activates the immune system to target and destroy cancer cells. This is achieved through the antibody’s ability to recruit immune cells, such as natural killer cells and macrophages, to the site of the cancer. These immune cells then work together to eliminate the cancer cells, providing a powerful anti-tumor effect.

Application of Sulesomab Biosimilar

Sulesomab Biosimilar has shown great potential in preclinical studies as a therapeutic agent for various types of cancer. Its unique mechanism of action, targeting NCA-90 and activating the immune system, makes it a promising candidate for cancer treatment. In fact, clinical trials have already been initiated to evaluate the safety and efficacy of Sulesomab Biosimilar in cancer patients.

Furthermore, Sulesomab Biosimilar has also been used in research settings to study the role of NCA-90 in cancer and to develop new diagnostic and therapeutic strategies. Its availability as a research grade antibody allows scientists to easily access and utilize this powerful tool in their studies.

Conclusion

Sulesomab Biosimilar is a revolutionary antibody that specifically targets NCA-90, a cell surface protein that is overexpressed in various types of cancer. Its unique structure and activity make it a promising therapeutic agent for cancer treatment, with potential applications in both clinical and research settings. As research and clinical trials continue to explore the potential of Sulesomab Biosimilar, it is clear that this antibody has the potential to make a significant impact in the fight against cancer.

Flow Cytometry results for Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

Flow Cytometry results for Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

SDS-PAGE for Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade

Sulesomab Biosimilar - Anti-CD66c;CEACAM6 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Sulesomab Biosimilar - Anti-NCA-90 mAb - Research Grade

There are no reviews yet.

Be the first to review “Sulesomab Biosimilar – Anti-NCA-90 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products