Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Blosozumab Biosimilar – Anti-SOST(sclerostin) mAb – Research Grade

  • PX-TA1267-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade

Product name Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 1132758-87-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Blosozumab,LY2541546,SOST(sclerostin),anti-SOST(sclerostin)
Reference PX-TA1267
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 1132758-87-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Blosozumab,LY2541546,SOST(sclerostin),anti-SOST(sclerostin)
Reference PX-TA1267
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1267-50
Uniprot ID Q9BQB4
Source CAS 1132758-87-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Blosozumab,LY2541546,SOST(sclerostin),anti-SOST(sclerostin)
Reference PX-TA1267
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

General information on Anti-SOST(sclerostin)[Homo sapiens] (Blosozumab) Monoclonal Antibody

Blosozumab has been inestigated for the treatment of Osteoporosis.

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb binds to Human SOST recombinant protein in indirect ELISA Assay

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb binds to Human SOST recombinant protein in indirect ELISA Assay

Immobilized Human SOST recombinant protein (cat. No.PX-P6275) at 0.5µg/mL (100µL/well) can bind to Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb (cat. No.PX-TA1267) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb - Research Grade

There are no reviews yet.

Be the first to review “Blosozumab Biosimilar – Anti-SOST(sclerostin) mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products