Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Besilesomab Biosimilar – Anti-CEACAM8, CD66b mAb – Research Grade

  • PX-TA1184-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €258.00.Current price is: €200.00.

100ug 22% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Besilesomab Biosimilar - Anti-CEACAM8, CD66b mAb - Research Grade

Product name Besilesomab Biosimilar - Anti-CEACAM8, CD66b mAb - Research Grade
Uniprot ID P31997
Source CAS 537694-98-7
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Besilesomab,BW250/183,CEACAM8, CD66b,anti-CEACAM8, CD66b
Reference PX-TA1184
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Besilesomab Biosimilar - Anti-CEACAM8, CD66b mAb - Research Grade
Uniprot ID P31997
Source CAS 537694-98-7
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Besilesomab,BW250/183,CEACAM8, CD66b,anti-CEACAM8, CD66b
Reference PX-TA1184
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1184-50
Uniprot ID P31997
Source CAS 537694-98-7
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Besilesomab,BW250/183,CEACAM8, CD66b,anti-CEACAM8, CD66b
Reference PX-TA1184
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Besilesomab Biosimilar, also known as Anti-CEACAM8, CD66b mAb, is a monoclonal antibody that targets the protein CEACAM8, also known as CD66b. This protein is a member of the carcinoembryonic antigen-related cell adhesion molecule (CEACAM) family and is primarily expressed on the surface of neutrophils and eosinophils. Besilesomab Biosimilar has been extensively studied for its potential therapeutic applications in various diseases.

Structure

Besilesomab Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced in the laboratory using genetic engineering techniques. It is composed of two heavy chains and two light chains, each consisting of amino acids. The antibody has a molecular weight of approximately 150 kDa and belongs to the immunoglobulin G (IgG) class. It has a similar structure to the human antibody, with the exception of a few amino acid substitutions to make it more stable and less immunogenic.

Activity

Besilesomab Biosimilar specifically binds to CEACAM8 on the surface of neutrophils and eosinophils. This binding triggers a cascade of events that leads to the activation of these immune cells. It promotes the release of inflammatory mediators and enhances the phagocytic activity of neutrophils and eosinophils. This activity is crucial in the body’s defense against bacterial and parasitic infections, making Besilesomab Biosimilar a potential therapeutic agent in these conditions.

Besilesomab Biosimilar has also been shown to have anti-inflammatory effects. It can inhibit the production of pro-inflammatory cytokines and reduce the recruitment of immune cells to sites of inflammation. This makes it a promising candidate for the treatment of inflammatory diseases such as rheumatoid arthritis and inflammatory bowel disease.

Application

Besilesomab Biosimilar is currently being investigated for its potential therapeutic applications in various diseases. Some of the key areas of research include:

Infectious diseases As Besilesomab Biosimilar targets CEACAM8, which is primarily expressed on neutrophils and eosinophils, it has been studied for its potential in treating infections caused by these immune cells. This includes conditions such as sepsis, pneumonia, and skin infections caused by Staphylococcus aureus. Clinical trials have shown promising results, with Besilesomab Biosimilar demonstrating efficacy in reducing the severity and duration of these infections.

Inflammatory diseases

Besilesomab Biosimilar has also shown potential in treating inflammatory diseases such as rheumatoid arthritis and inflammatory bowel disease. Studies have shown that it can reduce inflammation and improve symptoms in patients with these conditions. It is believed that the anti-inflammatory effects of Besilesomab Biosimilar are due to its ability to inhibit the production of pro-inflammatory cytokines and reduce the recruitment of immune cells to sites of inflammation.

Cancer

CEACAM8 is also overexpressed in certain types of cancer, including colon, breast, and lung cancer. Besilesomab Biosimilar has been studied for its potential in targeting and killing these cancer cells. Early studies have shown promising results, and further research is ongoing to determine its efficacy as a cancer treatment.

Conclusion

Besilesomab Biosimilar is a recombinant humanized monoclonal antibody that specifically targets CEACAM8 on the surface of neutrophils and eosinophils. It has been extensively studied for its potential therapeutic applications in various diseases, including infectious and inflammatory diseases, as well as cancer. Clinical trials have shown promising results, and further research is ongoing to determine its efficacy and safety as a therapeutic agent. Besilesomab Biosimilar has the potential to be a valuable addition to the current treatment options for these diseases.

Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade in ELISA Assay

Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade in ELISA Assay

Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade

SDS-PAGE for Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade

Besilesomab Biosimilar - Anti-CD66b;CEACAM8 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Besilesomab Biosimilar - Anti-CEACAM8, CD66b mAb - Research Grade

There are no reviews yet.

Be the first to review “Besilesomab Biosimilar – Anti-CEACAM8, CD66b mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products