Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Romosozumab Biosimilar – Anti-SOST mAb – Research Grade

  • PX-TA1281-50
  • Validated ELISA
Isotype:
IgG2, Kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Romosozumab Biosimilar - Anti-SOST mAb
Romosozumab Biosimilar - Anti-SOST mAb binds to Human SOST recombinant protein in Indirect ELISA Assay
Romosozumab Biosimilar - Anti-SOST mAb - Research Grade

Romosozumab Biosimilar - Anti-SOST mAb - Research Grade

Product name Romosozumab Biosimilar - Anti-SOST mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 909395-70-6
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Romosozumab,785A070802,AMG 785,CDP-7851,romosozumab-aqqg,sclerostin Ab,SOST,anti-SOST
Reference PX-TA1281
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Romosozumab Biosimilar - Anti-SOST mAb - Research Grade
Uniprot ID Q9BQB4
Source CAS 909395-70-6
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Romosozumab,785A070802,AMG 785,CDP-7851,romosozumab-aqqg,sclerostin Ab,SOST,anti-SOST
Reference PX-TA1281
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1281-50
Uniprot ID Q9BQB4
Source CAS 909395-70-6
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Molecular weight 146kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Romosozumab,785A070802,AMG 785,CDP-7851,romosozumab-aqqg,sclerostin Ab,SOST,anti-SOST
Reference PX-TA1281
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa

General information on Anti-SOST[Homo sapiens] (Romosozumab) Monoclonal Antibody

Romosozumab is a humanized monoclonal antibody used for the treatment of osteoperosis.

SDS-PAGE for Romosozumab Biosimilar - Anti-SOST mAb

SDS-PAGE for Romosozumab Biosimilar - Anti-SOST mAb

Romosozumab Biosimilar - Anti-SOST mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Romosozumab Biosimilar - Anti-SOST mAb binds to Human SOST recombinant protein in Indirect ELISA Assay

Romosozumab Biosimilar - Anti-SOST mAb binds to Human SOST recombinant protein in Indirect ELISA Assay

Immobilized Human SOST recombinant protein (cat. No.PX-P6275) at 0.5µg/mL (100µL/well) can bind to Romosozumab Biosimilar - Anti-SOST mAb (cat. No.PX-TA1281) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Romosozumab Biosimilar - Anti-SOST mAb - Research Grade

There are no reviews yet.

Be the first to review “Romosozumab Biosimilar – Anti-SOST mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products