60S ribosomal protein L10-like(RPL10L)

Reference:
Brand

Product type

Host Species

Size

,

Description of 60S ribosomal protein L10-like(RPL10L)

Product name60S ribosomal protein L10-like(RPL10L)
Uniprot IDP27635
Uniprot linkhttps://www.uniprot.org/uniprot/P27635
Origin speciesHomo sapiens (Human)
Expression systemProcaryotic expression
SequenceMGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGHMVSDEYEQLSSEALEAARICA NKYMVKSCGRDGFHMRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQN EEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAKKCLIPDGCGVKYVPSHGPLDKWRVLHS
Molecular weight24.52 kDa
Protein delivered with Tag?N terminus His tag
Purity estimated>90% by SDS-PAGE
BufferPBS pH 7.5, 0.02% SKL
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeMet1-Ser214
Protein AccessionP27635
Spec:Entrez GeneID6134
Spec:NCBI Gene AliasesQM; L10; NOV; AUTSX5; DXS648; MRXS35; DXS648E
Spec:SwissProtIDQ8TDA5
NCBI ReferenceP27635
Aliases /SynonymsDXS648E, QM,Laminin receptor homolog,Large ribosomal subunit protein uL16,Protein QM,Ribosomal protein L10,Tumor suppressor QM
ReferencePX-P4800
NoteFor research use only

Reviews

There are no reviews yet.

Be the first to review “60S ribosomal protein L10-like(RPL10L)”

Your email address will not be published. Required fields are marked *

Clear
OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us to order

+33 (0)3 90 20 54 70

Write us

Category: