Brand: ProteoGenix

Alpha-amylase – trypsin inhibitor CM3

PX-P4286-50
Quality Chart

Host species:: Insect
Uniprot ID:: P17314
Molecular weight:: 18.74kDa

Original price was: €265.00.Current price is: €210.00.

50ug 21% OFF + 210 loyalty points

Ser26–IIe168

Size Size

50ug Original price was: €265.00.Current price is: €210.00.
100ug Original price was: €372.00.Current price is: €329.00.
1MG Original price was: €1,183.00.Current price is: €954.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Alpha-amylase - trypsin inhibitor CM3

Product name	Alpha-amylase - trypsin inhibitor CM3
Uniprot ID	P17314
Uniprot link	https://www.uniprot.org/uniprot/P17314
Expression system	Eukaryotic expression
Raw Antigen Sequence	MKMIILVVSLHVLRNSAASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWIGSHHHHHH
Molecular weight	18.74kDa
Purity estimated	>50% by SDS-PAGE
Buffer	PBS, pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Fragment Type	Ser26-IIe168
Aliases /Synonyms	Chloroform/methanol-soluble protein CM3
Reference	PX-P4286
Note	For research use only
Molecular Constructor	Ser26–IIe168

Product name	Alpha-amylase - trypsin inhibitor CM3
Uniprot ID	P17314
Uniprot link	https://www.uniprot.org/uniprot/P17314
Expression system	Eukaryotic expression
Raw Antigen Sequence	MKMIILVVSLHVLRNSAASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWIGSHHHHHH
Molecular weight	18.74kDa
Purity estimated	>50% by SDS-PAGE
Buffer	PBS, pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Fragment Type	Ser26-IIe168
Aliases /Synonyms	Chloroform/methanol-soluble protein CM3
Reference	PX-P4286
Note	For research use only
Molecular Constructor	Ser26–IIe168

Product name	PX-P4286-1MG
Uniprot ID	P17314
Uniprot link	https://www.uniprot.org/uniprot/P17314
Expression system	Eukaryotic expression
Raw Antigen Sequence	MKMIILVVSLHVLRNSAASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWIGSHHHHHH
Molecular weight	18.74kDa
Purity estimated	>50% by SDS-PAGE
Buffer	PBS, pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Fragment Type	Ser26-IIe168
Aliases /Synonyms	Chloroform/methanol-soluble protein CM3
Reference	PX-P4286
Note	For research use only
Molecular Constructor	Ser26–IIe168