Alpha-amylase/trypsin inhibitor CM3
| Brand | |
|---|---|
| Product type | |
| Host Species |
Description of Alpha-amylase/trypsin inhibitor CM3
| Product name | Alpha-amylase/trypsin inhibitor CM3 |
|---|---|
| Uniprot ID | P17314 |
| Sequence | MKMIILVVSLHVLRNSAASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWIGSHHHHHH |
| Molecular weight | 18.74kDa |
| Purity estimated | >50% by SDS-PAGE |
| Buffer | PBS, pH 7.5 |
| Delivery condition | Blue ice (+4°) |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Insect |
| Reference | PX-P4286 |