Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Alpha-amylase – trypsin inhibitor CM3

  • PX-P4286-10
Host species:
Insect
Uniprot ID:
P17314
Molecular weight:
18.74kDa

€210.00

+ 210 loyalty points
Ser26–IIe168
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Alpha-amylase - trypsin inhibitor CM3

Alpha-amylase - trypsin inhibitor CM3

Product name Alpha-amylase - trypsin inhibitor CM3
Uniprot ID P17314
Uniprot link https://www.uniprot.org/uniprot/P17314
Expression system Eukaryotic expression
Sequence MKMIILVVSLHVLRNSAASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWIGSHHHHHH
Molecular weight 18.74kDa
Purity estimated >50% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser26-IIe168
Aliases /Synonyms Chloroform/methanol-soluble protein CM3
Reference PX-P4286
Note For research use only
Molecular Constructor
Ser26–IIe168
Product name Alpha-amylase - trypsin inhibitor CM3
Uniprot ID P17314
Uniprot link https://www.uniprot.org/uniprot/P17314
Expression system Eukaryotic expression
Sequence MKMIILVVSLHVLRNSAASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWIGSHHHHHH
Molecular weight 18.74kDa
Purity estimated >50% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser26-IIe168
Aliases /Synonyms Chloroform/methanol-soluble protein CM3
Reference PX-P4286
Note For research use only
Molecular Constructor
Ser26–IIe168

There are no reviews yet.

Be the first to review “Alpha-amylase – trypsin inhibitor CM3”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products